F213293

General Info

Members Datasets Scaffolds Average Seq Length
152 91 304 130

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10292767|Ga0065715_102927671
Length 147
Sequence MAISPRIDTDETRISRMLEIQDEHPDKLVHRAITEAIIGAAFEVHRELGYGFLERVYQRALQVELSRRGLSAEIEKRIRVQYKGVVVGDYDADLVVDDCVAVEIKINPQYDKRDEAQLLNELKATGLKVGLLLNFGRSKVEYKRLVF

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
81 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
82 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
83 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
84 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
85 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
86 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
87 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
91 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 2.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 2.63
Rhizosphere 94.08
Stem 0
Stem Tuber 0
Unclassified 31.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10292767 3300005293 Bacteria 1055
2 SwRhRL2b_contig_1726698 2162886007 Unclassified 980
3 SwRhRL2b_contig_3307056 2162886007 Bacteria 847
4 rootH1_10291459 3300003323 Bacteria 4246
5 Ga0058863_11741301 3300004799 Bacteria 847
6 Ga0058861_11668980 3300004800 Bacteria 678
7 Ga0058862_12462218 3300004803 Bacteria 690
8 Ga0065704_10004355 3300005289 Bacteria 5903
9 Ga0065704_10106103 3300005289 Unclassified 2092
10 Ga0065712_10613082 3300005290 Unclassified 585
11 Ga0065715_10050090 3300005293 Unclassified 1670
12 Ga0065707_10008128 3300005295 Bacteria 3246
13 Ga0070683_101749965 3300005329 Unclassified 598
14 Ga0070668_101454332 3300005347 Unclassified 626
15 Ga0070688_100238570 3300005365 Bacteria 1289
16 Ga0070711_100118502 3300005439 Bacteria 1954
17 Ga0070705_100038667 3300005440 Bacteria 2701
18 Ga0070708_100087921 3300005445 Unclassified 2824
19 Ga0070708_100198233 3300005445 Bacteria 1879
20 Ga0070708_100504092 3300005445 Unclassified 1142
21 Ga0070708_100652757 3300005445 Unclassified 991
22 Ga0070708_101361294 3300005445 Bacteria 662
23 Ga0070706_100178454 3300005467 Bacteria 1983
24 Ga0070706_100384202 3300005467 Bacteria 1307
25 Ga0070706_100518636 3300005467 Unclassified 1109
26 Ga0070706_100738645 3300005467 Unclassified 912
27 Ga0070706_100977345 3300005467 Bacteria 781
28 Ga0070706_101390044 3300005467 Bacteria 643
29 Ga0070707_100000049 3300005468 Bacteria 102972
30 Ga0070707_100007424 3300005468 Bacteria 10179
31 Ga0070707_100011639 3300005468 Bacteria 8209
32 Ga0070707_100030072 3300005468 Bacteria 5168
33 Ga0070707_100096066 3300005468 Bacteria 2870
34 Ga0070707_100411048 3300005468 Bacteria 1313
35 Ga0070707_100452576 3300005468 Bacteria 1244
36 Ga0070707_100605073 3300005468 Bacteria 1058
37 Ga0070707_100710280 3300005468 Bacteria 968
38 Ga0070707_100851847 3300005468 Unclassified 876
39 Ga0070698_100401475 3300005471 Bacteria 1304
40 Ga0070698_100916536 3300005471 Bacteria 822
41 Ga0070699_100088148 3300005518 Bacteria 2710
42 Ga0070699_100555063 3300005518 Unclassified 1046
43 Ga0070699_100961312 3300005518 Unclassified 783
44 Ga0070699_101312870 3300005518 Unclassified 664
45 Ga0070684_101267303 3300005535 Unclassified 693
46 Ga0070697_100000294 3300005536 Bacteria 40038
47 Ga0070697_100082532 3300005536 Bacteria 2649
48 Ga0070697_100124984 3300005536 Bacteria 2154
49 Ga0070697_100143015 3300005536 Bacteria 2012
50 Ga0070697_100195776 3300005536 Bacteria 1716
51 Ga0070697_100777254 3300005536 Bacteria 847
52 Ga0070697_101755821 3300005536 Bacteria 555
53 Ga0068853_100069483 3300005539 Bacteria 3064
54 Ga0070693_100634587 3300005547 Unclassified 775
55 Ga0068855_100083698 3300005563 Bacteria 3695
56 Ga0068855_100106768 3300005563 Bacteria 3218
57 Ga0068859_101227756 3300005617 Bacteria 826
58 Ga0081455_10055672 3300005937 Bacteria 3364
59 Ga0070717_10292436 3300006028 Bacteria 1447
60 Ga0070717_10835719 3300006028 Bacteria 838
61 Ga0070716_101475700 3300006173 Bacteria 555
62 Ga0070712_100069807 3300006175 Bacteria 2508
63 Ga0070712_100524302 3300006175 Bacteria 995
64 Ga0070712_101724163 3300006175 Bacteria 548
65 Ga0075362_10503639 3300006177 Unclassified 619
66 Ga0075434_100490645 3300006871 Unclassified 1249
67 Ga0075434_101466036 3300006871 Bacteria 692
68 Ga0075434_102169206 3300006871 Bacteria 560
69 Ga0068865_102128688 3300006881 Unclassified 510
70 Ga0075436_101047804 3300006914 Unclassified 613
71 Ga0097620_101227745 3300006931 Bacteria 826
72 Ga0099794_10173782 3300007265 Bacteria 1098
73 Ga0099795_10125703 3300007788 Bacteria 1030
74 Ga0099795_10593208 3300007788 Bacteria 526
75 Ga0105240_10797222 3300009093 Unclassified 1023
76 Ga0111539_10103526 3300009094 Bacteria 3341
77 Ga0111539_10636713 3300009094 Unclassified 1242
78 Ga0111539_12730452 3300009094 Unclassified 572
79 Ga0114129_10918237 3300009147 Bacteria 1108
80 Ga0105243_12763854 3300009148 Unclassified 531
81 Ga0105248_10203821 3300009177 Bacteria 2229
82 Ga0105237_10908470 3300009545 Bacteria 887
83 Ga0105237_11718412 3300009545 Unclassified 635
84 Ga0105239_10269101 3300010375 Bacteria 1916
85 Ga0157370_11727604 3300013104 Unclassified 562
86 Ga0157374_11143890 3300013296 Bacteria 799
87 Ga0157374_11663566 3300013296 Unclassified 663
88 Ga0157378_10394420 3300013297 Bacteria 1362
89 Ga0157378_10974103 3300013297 Bacteria 881
90 Ga0157378_11931339 3300013297 Unclassified 640
91 Ga0163162_10627105 3300013306 Bacteria 1200
92 Ga0157372_10804296 3300013307 Bacteria 1092
93 Ga0157375_11185693 3300013308 Bacteria 895
94 Ga0182006_1178398 3300015261 Bacteria 709
95 Ga0206356_10666900 3300020070 Bacteria 712
96 Ga0213876_10096358 3300021384 Bacteria 1567
97 Ga0207697_10252488 3300025315 Unclassified 780
98 Ga0207692_10546910 3300025898 Bacteria 739
99 Ga0207684_10177844 3300025910 Bacteria 1835
100 Ga0207684_10490817 3300025910 Unclassified 1053
101 Ga0207684_10497718 3300025910 Bacteria 1045
102 Ga0207684_11532983 3300025910 Unclassified 541
103 Ga0207695_10049105 3300025913 Bacteria 4451
104 Ga0207693_10151987 3300025915 Bacteria 1821
105 Ga0207663_10229856 3300025916 Bacteria 1354
106 Ga0207646_10000115 3300025922 Bacteria 110424
107 Ga0207646_10014842 3300025922 Bacteria 7380
108 Ga0207646_10161832 3300025922 Bacteria 2020
109 Ga0207646_10366030 3300025922 Bacteria 1302
110 Ga0207646_10533036 3300025922 Bacteria 1056
111 Ga0207646_10591837 3300025922 Bacteria 996
112 Ga0207646_10654399 3300025922 Unclassified 941
113 Ga0207646_10659998 3300025922 Unclassified 937
114 Ga0207646_10660366 3300025922 Unclassified 936
115 Ga0207650_10071884 3300025925 Bacteria 2603
116 Ga0207644_11171531 3300025931 Bacteria 646
117 Ga0207665_11345853 3300025939 Bacteria 569
118 Ga0207711_10328536 3300025941 Bacteria 1414
119 Ga0207661_11246657 3300025944 Unclassified 684
120 Ga0207667_10088062 3300025949 Bacteria 3211
121 Ga0207667_10282030 3300025949 Bacteria 1698
122 Ga0207639_10047154 3300026041 Bacteria 3255
123 Ga0207428_10695048 3300027907 Bacteria 728
124 Ga0207428_11189190 3300027907 Unclassified 531
125 Ga0265338_10002500 3300028800 Bacteria 27381
126 Ga0265324_10169497 3300029957 Bacteria 741
127 Ga0265320_10000362 3300031240 Bacteria 36921
128 Ga0265342_10134829 3300031712 Unclassified 1381
129 Ga0373947_1136451 3300035725 Unclassified 532
130 Ga0395900_0058753 3300037418 Bacteria 3959
131 Ga0395900_0560873 3300037418 Bacteria 1086
132 Ga0395898_0051085 3300037466 Unclassified 4044
133 Ga0436364_1228316 3300037853 Bacteria 865
134 Ga0395901_0058760 3300038443 Bacteria 4000
135 Ga0436365_0682001 3300039437 Bacteria 1810
136 Ga0436361_0083255 3300039447 Bacteria 942
137 Ga0436361_0549436 3300039447 Unclassified 656
138 Ga0495630_0638260 3300046517 Unclassified 816
139 Ga0495669_0371863 3300046684 Bacteria 691
140 Ga0495675_0820166 3300047444 Unclassified 514
141 Ga0496108_0120724 3300048911 Bacteria 2248
142 Ga0496109_0162545 3300048912 Bacteria 2092
143 Ga0496112_0472498 3300048915 Unclassified 1191
144 Ga0496113_0569583 3300048916 Bacteria 908
145 Ga0501259_178862 3300049688 Unclassified 536
146 Ga0501083_0119594 3300049744 Bacteria 1728
147 nmdc:mga08y16_1251645_c1 3300050511 Bacteria 711
148 nmdc:mga08y16_382036_c1 3300050511 Unclassified 1443
149 nmdc:mga0n895_108926_c1 3300050512 Bacteria 2785
150 nmdc:mga0n895_1365540_c1 3300050512 Bacteria 678
151 nmdc:mga08x19_943108_c1 3300050514 Unclassified 613
152 nmdc:mga0a205_855613_c1 3300050515 Unclassified 756
153 Ga0065715_10292767
154 SwRhRL2b_contig_1726698
155 SwRhRL2b_contig_3307056
156 rootH1_10291459
157 Ga0058863_11741301
158 Ga0058861_11668980
159 Ga0058862_12462218
160 Ga0065704_10004355
161 Ga0065704_10106103
162 Ga0065712_10613082
163 Ga0065715_10050090
164 Ga0065707_10008128
165 Ga0070683_101749965
166 Ga0070668_101454332
167 Ga0070688_100238570
168 Ga0070711_100118502
169 Ga0070705_100038667
170 Ga0070708_100087921
171 Ga0070708_100198233
172 Ga0070708_100504092
173 Ga0070708_100652757
174 Ga0070708_101361294
175 Ga0070706_100178454
176 Ga0070706_100384202
177 Ga0070706_100518636
178 Ga0070706_100738645
179 Ga0070706_100977345
180 Ga0070706_101390044
181 Ga0070707_100000049
182 Ga0070707_100007424
183 Ga0070707_100011639
184 Ga0070707_100030072
185 Ga0070707_100096066
186 Ga0070707_100411048
187 Ga0070707_100452576
188 Ga0070707_100605073
189 Ga0070707_100710280
190 Ga0070707_100851847
191 Ga0070698_100401475
192 Ga0070698_100916536
193 Ga0070699_100088148
194 Ga0070699_100555063
195 Ga0070699_100961312
196 Ga0070699_101312870
197 Ga0070684_101267303
198 Ga0070697_100000294
199 Ga0070697_100082532
200 Ga0070697_100124984
201 Ga0070697_100143015
202 Ga0070697_100195776
203 Ga0070697_100777254
204 Ga0070697_101755821
205 Ga0068853_100069483
206 Ga0070693_100634587
207 Ga0068855_100083698
208 Ga0068855_100106768
209 Ga0068859_101227756
210 Ga0081455_10055672
211 Ga0070717_10292436
212 Ga0070717_10835719
213 Ga0070716_101475700
214 Ga0070712_100069807
215 Ga0070712_100524302
216 Ga0070712_101724163
217 Ga0075362_10503639
218 Ga0075434_100490645
219 Ga0075434_101466036
220 Ga0075434_102169206
221 Ga0068865_102128688
222 Ga0075436_101047804
223 Ga0097620_101227745
224 Ga0099794_10173782
225 Ga0099795_10125703
226 Ga0099795_10593208
227 Ga0105240_10797222
228 Ga0111539_10103526
229 Ga0111539_10636713
230 Ga0111539_12730452
231 Ga0114129_10918237
232 Ga0105243_12763854
233 Ga0105248_10203821
234 Ga0105237_10908470
235 Ga0105237_11718412
236 Ga0105239_10269101
237 Ga0157370_11727604
238 Ga0157374_11143890
239 Ga0157374_11663566
240 Ga0157378_10394420
241 Ga0157378_10974103
242 Ga0157378_11931339
243 Ga0163162_10627105
244 Ga0157372_10804296
245 Ga0157375_11185693
246 Ga0182006_1178398
247 Ga0206356_10666900
248 Ga0213876_10096358
249 Ga0207697_10252488
250 Ga0207692_10546910
251 Ga0207684_10177844
252 Ga0207684_10490817
253 Ga0207684_10497718
254 Ga0207684_11532983
255 Ga0207695_10049105
256 Ga0207693_10151987
257 Ga0207663_10229856
258 Ga0207646_10000115
259 Ga0207646_10014842
260 Ga0207646_10161832
261 Ga0207646_10366030
262 Ga0207646_10533036
263 Ga0207646_10591837
264 Ga0207646_10654399
265 Ga0207646_10659998
266 Ga0207646_10660366
267 Ga0207650_10071884
268 Ga0207644_11171531
269 Ga0207665_11345853
270 Ga0207711_10328536
271 Ga0207661_11246657
272 Ga0207667_10088062
273 Ga0207667_10282030
274 Ga0207639_10047154
275 Ga0207428_10695048
276 Ga0207428_11189190
277 Ga0265338_10002500
278 Ga0265324_10169497
279 Ga0265320_10000362
280 Ga0265342_10134829
281 Ga0373947_1136451
282 Ga0395900_0058753
283 Ga0395900_0560873
284 Ga0395898_0051085
285 Ga0436364_1228316
286 Ga0395901_0058760
287 Ga0436365_0682001
288 Ga0436361_0083255
289 Ga0436361_0549436
290 Ga0495630_0638260
291 Ga0495669_0371863
292 Ga0495675_0820166
293 Ga0496108_0120724
294 Ga0496109_0162545
295 Ga0496112_0472498
296 Ga0496113_0569583
297 Ga0501259_178862
298 Ga0501083_0119594
299 nmdc:mga08y16_1251645_c1
300 nmdc:mga08y16_382036_c1
301 nmdc:mga0n895_108926_c1
302 nmdc:mga0n895_1365540_c1
303 nmdc:mga08x19_943108_c1
304 nmdc:mga0a205_855613_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13366

PDDEXK_3

PD-(D/E)XK nuclease superfamily

31

145

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6aqp-assembly1.cif.gz_D aspergillus fumigatus cytosolic thiolase: acetylated enzyme in complex with coa and potassium ions 0.8495 97 131
3goa-assembly1.cif.gz_A crystal structure of the salmonella typhimurium fada 3-ketoacyl-coa thiolase 0.8393 97 128
7fea-assembly1.cif.gz_B py14 in complex with col-d 0.8186 99 130
1y88-assembly1.cif.gz_A crystal structure of protein of unknown function af1548 0.774 37 118
6pcc-assembly1.cif.gz_A crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a 0.7689 97 121
ID Description Score Start End Superfamily
af_A0A1D6FCW8_19_445_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8624 97 131 3.40.47.10
af_P21151_3_386_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8618 97 131 3.40.47.10
1ulqE02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.833 97 130 3.40.47.10
af_Q8CAY6_6_396_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8254 97 131 3.40.47.10
3svkB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8241 99 129 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A2V6I7Q6-F1-model_v4 GxxExxY protein 0.9972 14 131
AF-A0A2V5VQG8-F1-model_v4 GxxExxY protein 0.9915 14 131
AF-A0A3M1P808-F1-model_v4 GxxExxY protein 0.9824 11 131
AF-A0A1V4RUM7-F1-model_v4 GxxExxY protein 0.9822 12 131
AF-A0A1V5P029-F1-model_v4 GxxExxY protein 0.9806 14 131

Map