F212921

General Info

Members Datasets Scaffolds Average Seq Length
151 111 302 144

Family's Representative Sequence

Representative Sequence 3300059426|Ga0590077_080643|Ga0590077_080643_199_702
Length 167
Sequence MRLLPRRRPRLRRSGPAPARDAVTEVAFHFNAPEKLAYACRLLRKAAASGAKVVVTGEPRLLRELDVALWTFAPLEFVAHCYAPAAGEAVVAASPVVLADTARQAPHQQVLVNLGAEVPEGFERFERLIEVVSQEDEDRQQARARWKHYADRGYAITRHDLATKESR

Samples

Sample ID Description Type Environment
1 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
30 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
32 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
68 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
69 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
70 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
71 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
72 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
73 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
74 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
75 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
76 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
77 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
78 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
79 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
80 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
81 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
106 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
107 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
108 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
109 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
110 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
111 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.87
Nodule 0
Rhizoplane 0
Rhizosphere 76.82
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590077_080643 3300059426 Unclassified 749
2 Ga0070658_10094098 3300005327 Bacteria 2472
3 Ga0070658_10484163 3300005327 Bacteria 1068
4 Ga0070658_10947033 3300005327 Bacteria 749
5 Ga0068869_100399595 3300005334 Bacteria 1130
6 Ga0070680_100062229 3300005336 Bacteria 3056
7 Ga0068868_100061944 3300005338 Bacteria 2964
8 Ga0070660_100078180 3300005339 Bacteria 2594
9 Ga0070668_101414619 3300005347 Bacteria 634
10 Ga0070671_100436757 3300005355 Bacteria 1122
11 Ga0070714_100237628 3300005435 Bacteria 1681
12 Ga0070678_100346066 3300005456 Bacteria 1277
13 Ga0070685_10316463 3300005466 Bacteria 1056
14 Ga0070679_100067383 3300005530 Bacteria 3569
15 Ga0070679_100101866 3300005530 Bacteria 2858
16 Ga0070672_100344450 3300005543 Bacteria 1270
17 Ga0070693_100679187 3300005547 Bacteria 752
18 Ga0068855_100016990 3300005563 Bacteria 8751
19 Ga0068859_101530618 3300005617 Unclassified 736
20 Ga0068863_100061822 3300005841 Bacteria 3541
21 Ga0075365_10131767 3300006038 Bacteria 1730
22 Ga0075365_10232804 3300006038 Bacteria 1293
23 Ga0075368_10043238 3300006042 Bacteria 1775
24 Ga0075362_10040992 3300006177 Bacteria 2040
25 Ga0075362_10154688 3300006177 Bacteria 1102
26 Ga0075362_10297225 3300006177 Bacteria 801
27 Ga0075367_10019771 3300006178 Bacteria 3739
28 Ga0075367_10179743 3300006178 Bacteria 1319
29 Ga0075367_10682915 3300006178 Bacteria 653
30 Ga0075366_10039802 3300006195 Bacteria 2778
31 Ga0075366_10106620 3300006195 Bacteria 1684
32 Ga0075366_10115115 3300006195 Bacteria 1619
33 Ga0075366_10435213 3300006195 Bacteria 809
34 Ga0097620_101530329 3300006931 Unclassified 736
35 Ga0105240_10025892 3300009093 Bacteria 7702
36 Ga0105240_11049492 3300009093 Bacteria 869
37 Ga0105243_10209632 3300009148 Bacteria 1715
38 Ga0105238_10245140 3300009551 Bacteria 1769
39 Ga0157375_11689009 3300013308 Bacteria 750
40 Ga0182008_10023937 3300014497 Bacteria 3112
41 Ga0213872_10000124 3300021361 Bacteria 72197
42 Ga0209673_1011962 3300025273 Bacteria 3533
43 Ga0209673_1060308 3300025273 Bacteria 952
44 Ga0209758_1048848 3300025297 Bacteria 1499
45 Ga0209051_1000406 3300025303 Bacteria 59626
46 Ga0209257_1000012 3300025304 Bacteria 1111138
47 Ga0207705_10283956 3300025909 Bacteria 1267
48 Ga0207705_10410559 3300025909 Bacteria 1048
49 Ga0207695_10095635 3300025913 Bacteria 2974
50 Ga0207657_10013318 3300025919 Bacteria 8067
51 Ga0207652_10022555 3300025921 Bacteria 5209
52 Ga0207681_11300605 3300025923 Unclassified 611
53 Ga0207664_10209449 3300025929 Bacteria 1686
54 Ga0207709_10192372 3300025935 Bacteria 1450
55 Ga0207691_10616290 3300025940 Bacteria 918
56 Ga0207689_10289919 3300025942 Bacteria 1356
57 Ga0207667_10217384 3300025949 Bacteria 1958
58 Ga0207668_11334177 3300025972 Bacteria 646
59 Ga0207677_10047834 3300026023 Bacteria 2875
60 Ga0209813_10022588 3300027866 Bacteria 1781
61 Ga0265319_1117532 3300028563 Bacteria 830
62 Ga0307515_10000577 3300028794 Bacteria 86068
63 Ga0265316_10000580 3300031344 Bacteria 40906
64 Ga0307513_10022011 3300031456 Bacteria 7508
65 Ga0307408_100121669 3300031548 Bacteria 2023
66 Ga0307408_100390646 3300031548 Bacteria 1192
67 Ga0307408_101834727 3300031548 Bacteria 580
68 Ga0307514_10002080 3300031649 Bacteria 21613
69 Ga0265314_10196162 3300031711 Bacteria 1197
70 Ga0265342_10135092 3300031712 Bacteria 1379
71 Ga0307407_10091601 3300031903 Bacteria 1865
72 Ga0307412_10047642 3300031911 Bacteria 2816
73 Ga0307409_101023010 3300031995 Bacteria 845
74 Ga0307416_102055149 3300032002 Bacteria 674
75 Ga0307414_10024786 3300032004 Bacteria 3831
76 Ga0307414_10201343 3300032004 Bacteria 1620
77 Ga0307510_10172220 3300033180 Bacteria 1742
78 Ga0395899_0004164 3300037312 Bacteria 11359
79 Ga0395900_0044654 3300037418 Bacteria 4565
80 Ga0395900_0129439 3300037418 Bacteria 2587
81 Ga0395900_0292283 3300037418 Bacteria 1618
82 Ga0395900_1509503 3300037418 Bacteria 584
83 Ga0395898_0013344 3300037466 Bacteria 8461
84 Ga0395905_0000339 3300037471 Bacteria 66527
85 Ga0395905_0000395 3300037471 Bacteria 61787
86 Ga0395905_0010734 3300037471 Bacteria 8881
87 Ga0395905_0068798 3300037471 Bacteria 3316
88 Ga0395905_0180735 3300037471 Bacteria 1980
89 Ga0395905_0469309 3300037471 Bacteria 1157
90 Ga0395901_0100719 3300038443 Bacteria 3031
91 Ga0395901_0151649 3300038443 Bacteria 2435
92 Ga0395901_0733839 3300038443 Bacteria 982
93 Ga0436361_0638016 3300039447 Bacteria 61418
94 Ga0439439_0025196 3300041406 Bacteria 1496
95 Ga0439465_0047246 3300041413 Bacteria 1403
96 Ga0451833_0972442 3300041491 Bacteria 500
97 Ga0439433_0013844 3300041999 Bacteria 1774
98 Ga0439445_0048215 3300042004 Bacteria 1145
99 Ga0439449_0001710 3300042007 Bacteria 8622
100 Ga0439457_025465 3300042014 Bacteria 1309
101 Ga0439462_0032246 3300042015 Bacteria 1388
102 Ga0439462_0145327 3300042015 Bacteria 665
103 Ga0450912_010203 3300042116 Bacteria 802
104 Ga0450915_004289 3300042119 Bacteria 839
105 Ga0450899_007678 3300042135 Bacteria 1176
106 Ga0450906_097297 3300042145 Bacteria 536
107 Ga0439446_0033526 3300042156 Bacteria 1492
108 Ga0439446_0064318 3300042156 Bacteria 1113
109 Ga0439434_0013665 3300042435 Bacteria 2411
110 Ga0450893_0013221 3300042532 Bacteria 1375
111 Ga0450893_0019081 3300042532 Bacteria 1171
112 Ga0451577_0015364 3300042876 Bacteria 7124
113 Ga0466965_0079546 3300044683 Bacteria 1656
114 Ga0466966_0097467 3300044684 Bacteria 1821
115 Ga0466961_0760541 3300044693 Bacteria 579
116 Ga0466971_0260470 3300044719 Bacteria 827
117 Ga0466968_0063650 3300044735 Bacteria 1594
118 Ga0466970_0443037 3300044765 Bacteria 744
119 Ga0466959_0262388 3300045049 Bacteria 1189
120 Ga0466959_0996517 3300045049 Bacteria 558
121 Ga0451576_0012808 3300045051 Bacteria 9410
122 Ga0451576_0335347 3300045051 Bacteria 1583
123 Ga0466958_0092167 3300045836 Bacteria 1876
124 Ga0466967_1813458 3300045976 Bacteria 607
125 Ga0495621_0084443 3300046539 Bacteria 1189
126 Ga0495621_0505181 3300046539 Bacteria 522
127 Ga0501034_0082141 3300049571 Bacteria 3224
128 Ga0501034_1022297 3300049571 Bacteria 710
129 Ga0501038_0102113 3300049574 Bacteria 2387
130 Ga0501043_0031534 3300049579 Bacteria 4166
131 Ga0501046_0124058 3300049580 Bacteria 1963
132 Ga0501047_0072183 3300049581 Bacteria 3322
133 Ga0501072_1132740 3300049588 Bacteria 608
134 Ga0501073_0288171 3300049589 Bacteria 1133
135 Ga0501074_0221547 3300049590 Bacteria 1347
136 Ga0501080_0049646 3300049742 Bacteria 3905
137 Ga0501035_0142351 3300049822 Bacteria 2084
138 Ga0501044_0031429 3300049823 Bacteria 5589
139 nmdc:mga03683_327355_c1 3300050489 Bacteria 722
140 nmdc:mga0yw44_345132_c1 3300050492 Bacteria 1002
141 nmdc:mga0yw44_416604_c1 3300050492 Bacteria 909
142 nmdc:mga0k408_113138_c1 3300050493 Bacteria 1605
143 nmdc:mga0k408_291888_c1 3300050493 Bacteria 973
144 nmdc:mga0k408_38559_c1 3300050493 Bacteria 2742
145 nmdc:mga0k408_465534_c1 3300050493 Bacteria 750
146 nmdc:mga0k408_51317_c1 3300050493 Bacteria 2389
147 nmdc:mga06z11_125235_c1 3300050494 Bacteria 1437
148 nmdc:mga06z11_882281_c1 3300050494 Bacteria 545
149 nmdc:mga04h51_73004_c1 3300050495 Bacteria 1202
150 2881102174 2881101125 Bacteria 4590519
151 2928118656 2928115317 Bacteria 6477646
152 Ga0590077_080643
153 Ga0070658_10094098
154 Ga0070658_10484163
155 Ga0070658_10947033
156 Ga0068869_100399595
157 Ga0070680_100062229
158 Ga0068868_100061944
159 Ga0070660_100078180
160 Ga0070668_101414619
161 Ga0070671_100436757
162 Ga0070714_100237628
163 Ga0070678_100346066
164 Ga0070685_10316463
165 Ga0070679_100067383
166 Ga0070679_100101866
167 Ga0070672_100344450
168 Ga0070693_100679187
169 Ga0068855_100016990
170 Ga0068859_101530618
171 Ga0068863_100061822
172 Ga0075365_10131767
173 Ga0075365_10232804
174 Ga0075368_10043238
175 Ga0075362_10040992
176 Ga0075362_10154688
177 Ga0075362_10297225
178 Ga0075367_10019771
179 Ga0075367_10179743
180 Ga0075367_10682915
181 Ga0075366_10039802
182 Ga0075366_10106620
183 Ga0075366_10115115
184 Ga0075366_10435213
185 Ga0097620_101530329
186 Ga0105240_10025892
187 Ga0105240_11049492
188 Ga0105243_10209632
189 Ga0105238_10245140
190 Ga0157375_11689009
191 Ga0182008_10023937
192 Ga0213872_10000124
193 Ga0209673_1011962
194 Ga0209673_1060308
195 Ga0209758_1048848
196 Ga0209051_1000406
197 Ga0209257_1000012
198 Ga0207705_10283956
199 Ga0207705_10410559
200 Ga0207695_10095635
201 Ga0207657_10013318
202 Ga0207652_10022555
203 Ga0207681_11300605
204 Ga0207664_10209449
205 Ga0207709_10192372
206 Ga0207691_10616290
207 Ga0207689_10289919
208 Ga0207667_10217384
209 Ga0207668_11334177
210 Ga0207677_10047834
211 Ga0209813_10022588
212 Ga0265319_1117532
213 Ga0307515_10000577
214 Ga0265316_10000580
215 Ga0307513_10022011
216 Ga0307408_100121669
217 Ga0307408_100390646
218 Ga0307408_101834727
219 Ga0307514_10002080
220 Ga0265314_10196162
221 Ga0265342_10135092
222 Ga0307407_10091601
223 Ga0307412_10047642
224 Ga0307409_101023010
225 Ga0307416_102055149
226 Ga0307414_10024786
227 Ga0307414_10201343
228 Ga0307510_10172220
229 Ga0395899_0004164
230 Ga0395900_0044654
231 Ga0395900_0129439
232 Ga0395900_0292283
233 Ga0395900_1509503
234 Ga0395898_0013344
235 Ga0395905_0000339
236 Ga0395905_0000395
237 Ga0395905_0010734
238 Ga0395905_0068798
239 Ga0395905_0180735
240 Ga0395905_0469309
241 Ga0395901_0100719
242 Ga0395901_0151649
243 Ga0395901_0733839
244 Ga0436361_0638016
245 Ga0439439_0025196
246 Ga0439465_0047246
247 Ga0451833_0972442
248 Ga0439433_0013844
249 Ga0439445_0048215
250 Ga0439449_0001710
251 Ga0439457_025465
252 Ga0439462_0032246
253 Ga0439462_0145327
254 Ga0450912_010203
255 Ga0450915_004289
256 Ga0450899_007678
257 Ga0450906_097297
258 Ga0439446_0033526
259 Ga0439446_0064318
260 Ga0439434_0013665
261 Ga0450893_0013221
262 Ga0450893_0019081
263 Ga0451577_0015364
264 Ga0466965_0079546
265 Ga0466966_0097467
266 Ga0466961_0760541
267 Ga0466971_0260470
268 Ga0466968_0063650
269 Ga0466970_0443037
270 Ga0466959_0262388
271 Ga0466959_0996517
272 Ga0451576_0012808
273 Ga0451576_0335347
274 Ga0466958_0092167
275 Ga0466967_1813458
276 Ga0495621_0084443
277 Ga0495621_0505181
278 Ga0501034_0082141
279 Ga0501034_1022297
280 Ga0501038_0102113
281 Ga0501043_0031534
282 Ga0501046_0124058
283 Ga0501047_0072183
284 Ga0501072_1132740
285 Ga0501073_0288171
286 Ga0501074_0221547
287 Ga0501080_0049646
288 Ga0501035_0142351
289 Ga0501044_0031429
290 nmdc:mga03683_327355_c1
291 nmdc:mga0yw44_345132_c1
292 nmdc:mga0yw44_416604_c1
293 nmdc:mga0k408_113138_c1
294 nmdc:mga0k408_291888_c1
295 nmdc:mga0k408_38559_c1
296 nmdc:mga0k408_465534_c1
297 nmdc:mga0k408_51317_c1
298 nmdc:mga06z11_125235_c1
299 nmdc:mga06z11_882281_c1
300 nmdc:mga04h51_73004_c1
301 2881102174
302 2928118656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04364

DNA_pol3_chi

DNA polymerase III chi subunit, HolC

23

157

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sxu-assembly1.cif.gz_A structure of the e. coli ssb-dna polymerase iii interface 0.8084 1 138
3sxu-assembly1.cif.gz_A structure of the e. coli ssb-dna polymerase iii interface 0.7729 1 138
6nmi-assembly1.cif.gz_A cryo-em structure of the human tfiih core complex 0.724 2 138
7t02-assembly1.cif.gz_A cryo-em structure of dnmt5 pseudo-ternary complex solved by incubation with hemimethylated dna and sam 0.7113 14 138
2oca-assembly1.cif.gz_A the crystal structure of t4 uvsw 0.7112 2 138
ID Description Score Start End Superfamily
1em8C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi 0.8514 1 138 3.40.50.10110
1em8C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;DNA polymerase III subunit chi 0.8133 1 138 3.40.50.10110
1wp9D02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7385 1 123 3.40.50.300
af_Q8IIT6_275_620_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7353 1 58 3.40.50.300
af_Q58969_243_408_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7196 2 128 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q4XRG3-F1-model_v4 DNA polymerase III subunit chi 0.9935 1 138 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A6N8IXN5-F1-model_v4 DNA polymerase III subunit chi 0.9885 1 142 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A0S9MSF6-F1-model_v4 DNA polymerase III subunit chi 0.9881 1 138 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A4Z0BZ15-F1-model_v4 DNA polymerase III subunit chi 0.988 1 144 GO:0003677
GO:0003887
GO:0006260
GO:0032298
AF-A0A433SFX9-F1-model_v4 DNA polymerase III subunit chi 0.9854 1 138 GO:0003677
GO:0003887
GO:0006260
GO:0032298

Map