F211377

General Info

Members Datasets Scaffolds Average Seq Length
151 92 150 251

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10064431|Ga0105240_100644312
Length 268
Sequence MVVATVAEAWFKLDQHHDMSTDMVLVTGASSGIGLELAKCFASEGCRLILVARKRDALHALAEELHRTHGTQAEVLTADLAESGAPSRIYEHVNNAGFGAHGAFAELPVERQLEMLQVNVVALTHLSRLFLPGMLQRKHGGLLNVASTAAFQPGPGMAVYYASKAFVLSFSEAIAEELAGSGVTVTALCPGPTATNFAKAANARFSHGLMRSAMPAESVARIGHRAFRDQRAVAIAGWRNQLLAFSVRLAPRAVVRKLVNFINAGEKI

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
78 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
79 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
82 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
83 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
84 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
85 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.66
Rhizosphere 98.01
Stem 0
Stem Tuber 0.66
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000381 3300001904 Bacteria 8409
2 Ga0065715_10173948 3300005293 Bacteria 1508
3 Ga0070658_10005583 3300005327 Bacteria 10201
4 Ga0070658_10008488 3300005327 Bacteria 8260
5 Ga0070658_10019253 3300005327 Bacteria 5468
6 Ga0070670_100168580 3300005331 Bacteria 1899
7 Ga0070680_100066275 3300005336 Bacteria 2961
8 Ga0070660_100018848 3300005339 Bacteria 5050
9 Ga0070660_100093157 3300005339 Bacteria 2378
10 Ga0070661_100026702 3300005344 Bacteria 4154
11 Ga0070663_100095031 3300005455 Bacteria 2215
12 Ga0070662_100026980 3300005457 Bacteria 3982
13 Ga0070662_100494015 3300005457 Bacteria 1020
14 Ga0070681_10117420 3300005458 Bacteria 2597
15 Ga0070681_10212531 3300005458 Bacteria 1850
16 Ga0070698_100009612 3300005471 Bacteria 10345
17 Ga0070679_100217367 3300005530 Bacteria 1873
18 Ga0070679_100218073 3300005530 Bacteria 1870
19 Ga0070679_100603720 3300005530 Bacteria 1041
20 Ga0068853_100215356 3300005539 Bacteria 1752
21 Ga0070665_100332529 3300005548 Bacteria 1524
22 Ga0068855_100001283 3300005563 Bacteria 31121
23 Ga0068855_100438405 3300005563 Bacteria 1427
24 Ga0068854_100040272 3300005578 Bacteria 3297
25 Ga0068856_100029568 3300005614 Bacteria 5352
26 Ga0068856_100442311 3300005614 Bacteria 1321
27 Ga0068852_100002966 3300005616 Bacteria 11788
28 Ga0068852_100040150 3300005616 Bacteria 3946
29 Ga0070717_10023565 3300006028 Unclassified 4879
30 Ga0075428_100090295 3300006844 Bacteria 3342
31 Ga0105240_10014198 3300009093 Bacteria 10878
32 Ga0105240_10064431 3300009093 Bacteria 4554
33 Ga0111539_10488526 3300009094 Bacteria 1434
34 Ga0111539_10753419 3300009094 Bacteria 1133
35 Ga0105249_10100267 3300009553 Bacteria 2723
36 Ga0157373_10000217 3300013100 Bacteria 47116
37 Ga0157373_10040487 3300013100 Bacteria 3334
38 Ga0157371_10001109 3300013102 Bacteria 29189
39 Ga0157371_10185184 3300013102 Bacteria 1490
40 Ga0157371_10476973 3300013102 Bacteria 919
41 Ga0157370_10059984 3300013104 Bacteria 3614
42 Ga0157370_10063726 3300013104 Bacteria 3491
43 Ga0157369_10000137 3300013105 Bacteria 103542
44 Ga0157369_10003724 3300013105 Bacteria 18107
45 Ga0157380_10005938 3300014326 Bacteria 8543
46 Ga0157380_10020467 3300014326 Bacteria 4946
47 Ga0207647_10062416 3300025904 Bacteria 2270
48 Ga0207705_10085619 3300025909 Bacteria 2302
49 Ga0207707_10585635 3300025912 Bacteria 945
50 Ga0207695_10007225 3300025913 Bacteria 14194
51 Ga0207695_10019685 3300025913 Bacteria 7762
52 Ga0207660_10060883 3300025917 Bacteria 2716
53 Ga0207657_10002077 3300025919 Bacteria 21670
54 Ga0207690_10032276 3300025932 Bacteria 3359
55 Ga0207706_10001767 3300025933 Bacteria 21221
56 Ga0207667_10044781 3300025949 Bacteria 4688
57 Ga0207668_10079353 3300025972 Bacteria 2374
58 Ga0207640_10001170 3300025981 Bacteria 14401
59 Ga0207678_10022643 3300026067 Bacteria 5502
60 Ga0207702_10005617 3300026078 Bacteria 10942
61 Ga0207702_10058697 3300026078 Bacteria 3275
62 Ga0207698_10001404 3300026142 Bacteria 13990
63 Ga0209974_10034506 3300027876 Bacteria 1680
64 Ga0209974_10130307 3300027876 Bacteria 896
65 Ga0268266_10260174 3300028379 Bacteria 1608
66 Ga0268265_10272991 3300028380 Bacteria 1509
67 Ga0268265_10555270 3300028380 Bacteria 1091
68 Ga0265337_1000093 3300028556 Bacteria 43981
69 Ga0265337_1008808 3300028556 Bacteria 3638
70 Ga0265337_1084224 3300028556 Bacteria 868
71 Ga0265334_10001605 3300028573 Bacteria 10863
72 Ga0265323_10026329 3300028653 Bacteria 2193
73 Ga0265338_10003461 3300028800 Bacteria 22221
74 Ga0265338_10009956 3300028800 Bacteria 11238
75 Ga0265338_10015570 3300028800 Bacteria 8335
76 Ga0265338_10016966 3300028800 Bacteria 7879
77 Ga0265338_10027385 3300028800 Bacteria 5719
78 Ga0265338_10059290 3300028800 Bacteria 3372
79 Ga0265325_10005103 3300031241 Bacteria 8171
80 Ga0265325_10073067 3300031241 Unclassified 1717
81 Ga0265340_10096939 3300031247 Unclassified 1374
82 Ga0265339_10004593 3300031249 Bacteria 9397
83 Ga0265327_10007386 3300031251 Bacteria 8505
84 Ga0265316_10000976 3300031344 Bacteria 31061
85 Ga0265316_10010273 3300031344 Bacteria 8541
86 Ga0307408_100052355 3300031548 Bacteria 2944
87 Ga0265313_10002036 3300031595 Bacteria 18138
88 Ga0316579_10003507 3300031691 Bacteria 6132
89 Ga0307405_10011770 3300031731 Bacteria 4603
90 Ga0307405_10020069 3300031731 Bacteria 3727
91 Ga0307405_10020099 3300031731 Bacteria 3725
92 Ga0307413_10019956 3300031824 Bacteria 3554
93 Ga0307413_10113951 3300031824 Bacteria 1816
94 Ga0307410_10046224 3300031852 Bacteria 2903
95 Ga0307410_10083856 3300031852 Bacteria 2245
96 Ga0307410_10121368 3300031852 Bacteria 1906
97 Ga0307410_10145969 3300031852 Bacteria 1756
98 Ga0307406_10008162 3300031901 Bacteria 5832
99 Ga0307406_10032185 3300031901 Bacteria 3200
100 Ga0307406_10316668 3300031901 Bacteria 1205
101 Ga0307412_10006074 3300031911 Bacteria 6800
102 Ga0307412_10037404 3300031911 Bacteria 3118
103 Ga0307412_10067021 3300031911 Bacteria 2436
104 Ga0307409_100030732 3300031995 Bacteria 3864
105 Ga0307409_100123941 3300031995 Bacteria 2194
106 Ga0307416_100004794 3300032002 Bacteria 8216
107 Ga0307416_100012937 3300032002 Bacteria 5649
108 Ga0307416_100025798 3300032002 Bacteria 4317
109 Ga0307414_10059518 3300032004 Bacteria 2697
110 Ga0307414_10132321 3300032004 Bacteria 1938
111 Ga0307414_10402094 3300032004 Bacteria 1190
112 Ga0307414_10555975 3300032004 Bacteria 1023
113 Ga0307411_10021815 3300032005 Bacteria 3757
114 Ga0307411_10063373 3300032005 Bacteria 2470
115 Ga0307411_10516383 3300032005 Bacteria 1013
116 Ga0307415_100021144 3300032126 Bacteria 3992
117 Ga0307415_100333503 3300032126 Bacteria 1270
118 Ga0373935_0024789 3300035692 Bacteria 3694
119 Ga0395900_0132355 3300037418 Bacteria 2555
120 Ga0395900_0200355 3300037418 Bacteria 2020
121 Ga0395898_0456619 3300037466 Bacteria 1216
122 Ga0395905_0056376 3300037471 Bacteria 3676
123 Ga0395905_0585026 3300037471 Bacteria 1018
124 Ga0395905_0846288 3300037471 Bacteria 818
125 Ga0436364_0383227 3300037853 Bacteria 945
126 Ga0395901_0129052 3300038443 Bacteria 2657
127 Ga0395901_0478931 3300038443 Bacteria 1270
128 Ga0436361_1218740 3300039447 Bacteria 6933
129 Ga0436362_0217275 3300039453 Bacteria 3595
130 Ga0436362_0490222 3300039453 Bacteria 6010
131 Ga0436362_0631815 3300039453 Bacteria 850
132 Ga0439445_0000193 3300042004 Bacteria 11053
133 Ga0439445_0002038 3300042004 Bacteria 4457
134 Ga0439434_0062604 3300042435 Bacteria 1165
135 Ga0439464_0041238 3300042439 Bacteria 1316
136 Ga0439464_0053448 3300042439 Bacteria 1172
137 Ga0466966_0000026 3300044684 Bacteria 106896
138 Ga0495663_0001206 3300046525 Bacteria 8325
139 Ga0495642_0011555 3300046528 Bacteria 3394
140 Ga0495598_0004766 3300046537 Bacteria 2960
141 Ga0495621_0014832 3300046539 Bacteria 2474
142 Ga0495659_0015826 3300046664 Bacteria 2483
143 Ga0495670_0004875 3300046691 Bacteria 6589
144 Ga0495670_0253568 3300046691 Bacteria 938
145 Ga0496108_0009464 3300048911 Bacteria 7891
146 Ga0501034_0121451 3300049571 Bacteria 2599
147 Ga0501047_0298829 3300049581 Bacteria 1453
148 Ga0501268_004142 3300049765 Bacteria 2028
149 Ga0501035_0236521 3300049822 Bacteria 1555
150 Ga0501044_0576851 3300049823 Bacteria 1020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100009612 Ga0070698_1000096123 211
2 3300006028 Ga0070717_10023565 Ga0070717_100235653 211
3 3300039453 Ga0436362_0631815 Ga0436362_0631815_140_793 211
4 3300031731 Ga0307405_10020099 Ga0307405_100200993 217
5 3300032002 Ga0307416_100012937 Ga0307416_1000129372 217
6 3300032005 Ga0307411_10021815 Ga0307411_100218153 217
7 3300032126 Ga0307415_100021144 Ga0307415_1000211442 217
8 3300049765 Ga0501268_004142 Ga0501268_004142_244_996 217
9 3300037471 Ga0395905_0846288 Ga0395905_0846288_131_793 220
10 3300028379 Ga0268266_10260174 Ga0268266_102601742 224
11 3300048911 Ga0496108_0009464 Ga0496108_0009464_4067_4828 225
12 3300037418 Ga0395900_0200355 Ga0395900_0200355_1175_1891 228
13 3300037471 Ga0395905_0585026 Ga0395905_0585026_246_962 228
14 3300038443 Ga0395901_0478931 Ga0395901_0478931_151_867 228
15 3300028800 Ga0265338_10016966 Ga0265338_100169665 232
16 3300031251 Ga0265327_10007386 Ga0265327_100073865 232
17 3300005530 Ga0070679_100217367 Ga0070679_1002173671 237
18 3300037466 Ga0395898_0456619 Ga0395898_0456619_15_785 241
19 3300009093 Ga0105240_10064431 Ga0105240_100644312 245
20 3300025913 Ga0207695_10019685 Ga0207695_100196855 245
21 3300005339 Ga0070660_100018848 Ga0070660_1000188483 246
22 3300005563 Ga0068855_100438405 Ga0068855_1004384052 246
23 3300025909 Ga0207705_10085619 Ga0207705_100856192 246
24 3300026078 Ga0207702_10058697 Ga0207702_100586972 246
25 iso_pu_bacteria 2885427238 2885429137 247
26 3300025949 Ga0207667_10044781 Ga0207667_100447815 248
27 3300026078 Ga0207702_10005617 Ga0207702_1000561712 248
28 3300044684 Ga0466966_0000026 Ga0466966_0000026_42220_42966 248
29 3300005457 Ga0070662_100494015 Ga0070662_1004940151 249
30 3300031548 Ga0307408_100052355 Ga0307408_1000523553 249
31 3300031731 Ga0307405_10011770 Ga0307405_100117703 249
32 3300031824 Ga0307413_10113951 Ga0307413_101139511 249
33 3300031852 Ga0307410_10083856 Ga0307410_100838562 249
34 3300031901 Ga0307406_10008162 Ga0307406_100081624 249
35 3300031901 Ga0307406_10032185 Ga0307406_100321852 249
36 3300031911 Ga0307412_10006074 Ga0307412_100060743 249
37 3300031995 Ga0307409_100123941 Ga0307409_1001239411 249
38 3300032002 Ga0307416_100004794 Ga0307416_1000047944 249
39 3300032004 Ga0307414_10059518 Ga0307414_100595182 249
40 3300032005 Ga0307411_10063373 Ga0307411_100633732 249
41 3300037853 Ga0436364_0383227 Ga0436364_0383227_169_921 249
42 3300005293 Ga0065715_10173948 Ga0065715_101739482 250
43 3300009094 Ga0111539_10753419 Ga0111539_107534192 250
44 3300027876 Ga0209974_10034506 Ga0209974_100345062 250
45 3300031731 Ga0307405_10020069 Ga0307405_100200693 250
46 3300031824 Ga0307413_10019956 Ga0307413_100199563 250
47 3300031852 Ga0307410_10046224 Ga0307410_100462242 250
48 3300031911 Ga0307412_10037404 Ga0307412_100374042 250
49 3300031995 Ga0307409_100030732 Ga0307409_1000307323 250
50 3300032002 Ga0307416_100025798 Ga0307416_1000257983 250
51 3300032004 Ga0307414_10555975 Ga0307414_105559752 250
52 3300035692 Ga0373935_0024789 Ga0373935_0024789_1391_2143 250
53 3300042435 Ga0439434_0062604 Ga0439434_0062604_247_999 250
54 3300005327 Ga0070658_10008488 Ga0070658_100084888 251
55 3300005539 Ga0068853_100215356 Ga0068853_1002153563 251
56 3300006844 Ga0075428_100090295 Ga0075428_1000902954 251
57 3300009553 Ga0105249_10100267 Ga0105249_101002672 251
58 3300013100 Ga0157373_10040487 Ga0157373_100404873 251
59 3300013102 Ga0157371_10476973 Ga0157371_104769731 251
60 3300013104 Ga0157370_10063726 Ga0157370_100637262 251
61 3300025919 Ga0207657_10002077 Ga0207657_1000207711 251
62 3300031691 Ga0316579_10003507 Ga0316579_100035074 251
63 3300031852 Ga0307410_10121368 Ga0307410_101213681 251
64 3300031852 Ga0307410_10145969 Ga0307410_101459693 251
65 3300031901 Ga0307406_10316668 Ga0307406_103166682 251
66 3300031911 Ga0307412_10067021 Ga0307412_100670215 251
67 3300032004 Ga0307414_10132321 Ga0307414_101323213 251
68 3300032004 Ga0307414_10402094 Ga0307414_104020942 251
69 3300032005 Ga0307411_10516383 Ga0307411_105163831 251
70 3300032126 Ga0307415_100333503 Ga0307415_1003335032 251
71 3300037418 Ga0395900_0132355 Ga0395900_0132355_1540_2295 251
72 3300038443 Ga0395901_0129052 Ga0395901_0129052_1374_2129 251
73 3300042439 Ga0439464_0053448 Ga0439464_0053448_358_1119 251
74 3300046528 Ga0495642_0011555 Ga0495642_0011555_313_1068 251
75 3300046664 Ga0495659_0015826 Ga0495659_0015826_1597_2352 251
76 3300046691 Ga0495670_0253568 Ga0495670_0253568_145_900 251
77 3300005327 Ga0070658_10005583 Ga0070658_100055834 252
78 3300005331 Ga0070670_100168580 Ga0070670_1001685802 252
79 3300005336 Ga0070680_100066275 Ga0070680_1000662752 252
80 3300005339 Ga0070660_100093157 Ga0070660_1000931571 252
81 3300005455 Ga0070663_100095031 Ga0070663_1000950312 252
82 3300005457 Ga0070662_100026980 Ga0070662_1000269805 252
83 3300005458 Ga0070681_10117420 Ga0070681_101174202 252
84 3300005458 Ga0070681_10212531 Ga0070681_102125312 252
85 3300005530 Ga0070679_100218073 Ga0070679_1002180732 252
86 3300005530 Ga0070679_100603720 Ga0070679_1006037202 252
87 3300005548 Ga0070665_100332529 Ga0070665_1003325292 252
88 3300013100 Ga0157373_10000217 Ga0157373_100002174 252
89 3300014326 Ga0157380_10005938 Ga0157380_100059387 252
90 3300014326 Ga0157380_10020467 Ga0157380_100204673 252
91 3300025912 Ga0207707_10585635 Ga0207707_105856352 252
92 3300025917 Ga0207660_10060883 Ga0207660_100608832 252
93 3300025932 Ga0207690_10032276 Ga0207690_100322763 252
94 3300025933 Ga0207706_10001767 Ga0207706_100017679 252
95 3300025972 Ga0207668_10079353 Ga0207668_100793532 252
96 3300027876 Ga0209974_10130307 Ga0209974_101303071 252
97 3300028380 Ga0268265_10272991 Ga0268265_102729911 252
98 3300028380 Ga0268265_10555270 Ga0268265_105552702 252
99 3300028556 Ga0265337_1008808 Ga0265337_10088083 252
100 3300028800 Ga0265338_10027385 Ga0265338_100273853 252
101 3300037471 Ga0395905_0056376 Ga0395905_0056376_2341_3099 252
102 3300042004 Ga0439445_0000193 Ga0439445_0000193_8774_9532 252
103 3300042004 Ga0439445_0002038 Ga0439445_0002038_3519_4277 252
104 3300042439 Ga0439464_0041238 Ga0439464_0041238_53_811 252
105 3300046525 Ga0495663_0001206 Ga0495663_0001206_6578_7336 252
106 3300046537 Ga0495598_0004766 Ga0495598_0004766_1061_1819 252
107 3300046539 Ga0495621_0014832 Ga0495621_0014832_1252_2010 252
108 3300046691 Ga0495670_0004875 Ga0495670_0004875_4361_5119 252
109 3300049571 Ga0501034_0121451 Ga0501034_0121451_1678_2472 252
110 3300049581 Ga0501047_0298829 Ga0501047_0298829_279_1073 252
111 3300049822 Ga0501035_0236521 Ga0501035_0236521_435_1229 252
112 3300049823 Ga0501044_0576851 Ga0501044_0576851_120_914 252
113 3300028556 Ga0265337_1000093 Ga0265337_100009341 255
114 3300028653 Ga0265323_10026329 Ga0265323_100263292 255
115 3300028800 Ga0265338_10003461 Ga0265338_100034617 255
116 3300028800 Ga0265338_10009956 Ga0265338_100099563 255
117 3300028800 Ga0265338_10015570 Ga0265338_100155709 255
118 3300031241 Ga0265325_10005103 Ga0265325_100051037 255
119 3300031241 Ga0265325_10073067 Ga0265325_100730672 255
120 3300031247 Ga0265340_10096939 Ga0265340_100969392 255
121 3300031249 Ga0265339_10004593 Ga0265339_1000459310 255
122 3300031344 Ga0265316_10000976 Ga0265316_1000097616 255
123 3300031344 Ga0265316_10010273 Ga0265316_100102735 255
124 3300031595 Ga0265313_10002036 Ga0265313_100020362 255
125 3300039447 Ga0436361_1218740 Ga0436361_1218740_3371_4309 255
126 3300039453 Ga0436362_0217275 Ga0436362_0217275_136_933 255
127 3300039453 Ga0436362_0490222 Ga0436362_0490222_2147_2944 255
128 3300001904 JGI24736J21556_1000381 JGI24736J21556_10003814 256
129 3300005327 Ga0070658_10019253 Ga0070658_100192537 256
130 3300005344 Ga0070661_100026702 Ga0070661_1000267022 256
131 3300005563 Ga0068855_100001283 Ga0068855_1000012837 256
132 3300005578 Ga0068854_100040272 Ga0068854_1000402722 256
133 3300005614 Ga0068856_100029568 Ga0068856_1000295682 256
134 3300005614 Ga0068856_100442311 Ga0068856_1004423112 256
135 3300005616 Ga0068852_100002966 Ga0068852_10000296611 256
136 3300005616 Ga0068852_100040150 Ga0068852_1000401502 256
137 3300009093 Ga0105240_10014198 Ga0105240_100141989 256
138 3300009094 Ga0111539_10488526 Ga0111539_104885261 256
139 3300013102 Ga0157371_10001109 Ga0157371_1000110913 256
140 3300013102 Ga0157371_10185184 Ga0157371_101851842 256
141 3300013104 Ga0157370_10059984 Ga0157370_100599842 256
142 3300013105 Ga0157369_10000137 Ga0157369_1000013745 256
143 3300013105 Ga0157369_10003724 Ga0157369_1000372410 256
144 3300025904 Ga0207647_10062416 Ga0207647_100624162 256
145 3300025913 Ga0207695_10007225 Ga0207695_100072259 256
146 3300025981 Ga0207640_10001170 Ga0207640_100011704 256
147 3300026067 Ga0207678_10022643 Ga0207678_100226434 256
148 3300026142 Ga0207698_10001404 Ga0207698_1000140410 256
149 3300028556 Ga0265337_1084224 Ga0265337_10842241 256
150 3300028573 Ga0265334_10001605 Ga0265334_100016054 256
151 3300028800 Ga0265338_10059290 Ga0265338_100592903 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

22

205

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

28

225

0.89

PF08659

KR

KR domain

23

195

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e24-assembly2.cif.gz_C crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.9261 9 231
7e3x-assembly1.cif.gz_B crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.9178 7 230
7e6o-assembly1.cif.gz_B crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9114 5 183
5fyd-assembly1.cif.gz_A structural and biochemical insights into 7beta-hydroxysteroid dehydrogenase stereoselectivity 0.9075 5 250
1x7g-assembly1.cif.gz_B-2 actinorhodin polyketide ketoreductase, act kr, with nadp bound 0.9065 7 228
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.927 88 186 3.40.50.720
af_Q54Q55_35_290_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9208 7 214 3.40.50.720
af_I6Y9I3_9_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9204 7 246 3.40.50.720
3h7aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9119 6 182 3.40.50.720
af_Q99J47_40_321_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9086 6 243 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A520Y695-F1-model_v4 SDR family oxidoreductase 0.9823 7 230 GO:0016020
GO:0016491
AF-A0A368K2G7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9712 12 255 GO:0016491
AF-A0A0F3FQB1-F1-model_v4 deleted 0.9711 6 256
AF-A0A357T7Q1-F1-model_v4 Short-chain dehydrogenase 0.9711 9 255 GO:0016020
GO:0016491
AF-A0A4Z1AAN3-F1-model_v4 SDR family oxidoreductase 0.97 7 256 GO:0016491

Feature Viewer

pLDDT pTM Quality
89.7 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map