F210521

General Info

Members Datasets Scaffolds Average Seq Length
151 115 146 208

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10274138|Ga0070658_102741382
Length 235
Sequence LRTQRKIAFYNGLSNWLGALQNMLPLRMGIINYTTFIITSFLFILSPGIDTIFILNKSIAQGKRLGLYSTLGITTGVLVHTTFAAFGLSLILAQSATAFNVVKYLGAAYLVYLGIIKLFVRENIIKKEGQSQALSVKKTYLSAVLTNSLNPKVAIFFLAFFPQFIRPAYMHYASPFIVLGITYGLISLLWFTVLTLFAGAFSHKLQSNPSIEMWLNKFSGAVFILMGLKVALTKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2739367651 Pedobacter sp. OK291 Isolate Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
63 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
73 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
74 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
75 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
76 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
77 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
78 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
79 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
80 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
81 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
105 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
111 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
112 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.97
Nodule 1.99
Rhizoplane 1.32
Rhizosphere 87.42
Stem 0
Stem Tuber 0
Unclassified 5.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_310132 2162886007 Bacteria 10317
2 SwRhRL2b_contig_519107 2162886007 Bacteria 15803
3 rootH1_10002752 3300003323 Bacteria 22251
4 rootH1_10038638 3300003323 Bacteria 5097
5 Ga0065714_10003470 3300005288 Bacteria 14235
6 Ga0065714_10014690 3300005288 Bacteria 2329
7 Ga0065714_10090367 3300005288 Bacteria 1947
8 Ga0065704_10000223 3300005289 Bacteria 110188
9 Ga0065704_10070812 3300005289 Bacteria 15813
10 Ga0065707_10000483 3300005295 Bacteria 53504
11 Ga0070658_10274138 3300005327 Bacteria 1435
12 Ga0070683_100016399 3300005329 Bacteria 6534
13 Ga0070683_100397187 3300005329 Bacteria 1315
14 Ga0070661_100048394 3300005344 Bacteria 3112
15 Ga0070675_100331193 3300005354 Bacteria 1347
16 Ga0070671_100134956 3300005355 Unclassified 2080
17 Ga0070673_100542170 3300005364 Bacteria 1056
18 Ga0070667_100333722 3300005367 Bacteria 1370
19 Ga0070708_100036998 3300005445 Bacteria 4256
20 Ga0070699_100010700 3300005518 Bacteria 7939
21 Ga0070696_100471277 3300005546 Bacteria 994
22 Ga0068855_100033925 3300005563 Bacteria 6089
23 Ga0070664_100012764 3300005564 Bacteria 6835
24 Ga0068854_100010430 3300005578 Bacteria 6026
25 Ga0068852_100163867 3300005616 Bacteria 2078
26 Ga0068860_100004779 3300005843 Bacteria 13804
27 Ga0070717_10407912 3300006028 Unclassified 1221
28 Ga0075366_10000041 3300006195 Bacteria 45335
29 Ga0075433_10168314 3300006852 Unclassified 1950
30 Ga0075429_100000170 3300006880 Bacteria 41847
31 Ga0075429_100337102 3300006880 Bacteria 1320
32 Ga0105240_10007062 3300009093 Bacteria 16373
33 Ga0114129_10000806 3300009147 Bacteria 40261
34 Ga0114129_10006829 3300009147 Bacteria 16216
35 Ga0114129_10300394 3300009147 Bacteria 2140
36 Ga0114129_11688022 3300009147 Bacteria 773
37 Ga0105237_10002465 3300009545 Bacteria 22965
38 Ga0105237_10002626 3300009545 Bacteria 22110
39 Ga0105237_10004143 3300009545 Bacteria 16893
40 Ga0105239_10001267 3300010375 Bacteria 34182
41 Ga0105239_10007161 3300010375 Bacteria 12836
42 Ga0105239_10043304 3300010375 Bacteria 4934
43 Ga0157373_10000253 3300013100 Bacteria 43594
44 Ga0157373_10007074 3300013100 Bacteria 8365
45 Ga0157371_10000117 3300013102 Bacteria 121069
46 Ga0157371_10003781 3300013102 Bacteria 13550
47 Ga0157370_10258560 3300013104 Bacteria 1609
48 Ga0157369_10000047 3300013105 Bacteria 172682
49 Ga0157369_10000301 3300013105 Bacteria 66010
50 Ga0163162_10001657 3300013306 Bacteria 20874
51 Ga0163162_10284809 3300013306 Bacteria 1784
52 Ga0163162_11148010 3300013306 Unclassified 881
53 Ga0157372_10000037 3300013307 Bacteria 172444
54 Ga0157380_10398507 3300014326 Unclassified 1305
55 Ga0182008_10000001 3300014497 Bacteria 540790
56 Ga0157379_10523347 3300014968 Bacteria 1101
57 Ga0182006_1005403 3300015261 Bacteria 6101
58 Ga0182007_10000005 3300015262 Bacteria 442702
59 Ga0163161_10006093 3300017792 Bacteria 8354
60 Ga0163161_10061772 3300017792 Unclassified 2728
61 Ga0209437_100119 3300025233 Bacteria 206549
62 Ga0207695_10023004 3300025913 Bacteria 7058
63 Ga0207695_10212684 3300025913 Bacteria 1843
64 Ga0207671_10001872 3300025914 Bacteria 23401
65 Ga0207671_10003904 3300025914 Bacteria 14529
66 Ga0207650_10417898 3300025925 Unclassified 1112
67 Ga0207659_10399230 3300025926 Bacteria 1150
68 Ga0207644_10825064 3300025931 Unclassified 776
69 Ga0207661_10033382 3300025944 Bacteria 3994
70 Ga0207661_10051932 3300025944 Bacteria 3273
71 Ga0207679_10045293 3300025945 Bacteria 3181
72 Ga0207679_10266887 3300025945 Bacteria 1462
73 Ga0207667_10103029 3300025949 Bacteria 2944
74 Ga0207640_10008596 3300025981 Bacteria 5672
75 Ga0207658_10093572 3300025986 Bacteria 2337
76 Ga0207675_101102082 3300026118 Unclassified 814
77 Ga0207698_10169612 3300026142 Bacteria 1920
78 Ga0207698_10616605 3300026142 Bacteria 1071
79 Ga0209999_1020952 3300027543 Bacteria 1201
80 Ga0210002_1025134 3300027617 Bacteria 973
81 Ga0268264_10003505 3300028381 Bacteria 13525
82 Ga0307515_10009296 3300028794 Bacteria 19016
83 Ga0316183_1079280 3300030742 Bacteria 54147
84 Ga0316181_1155779 3300030744 Bacteria 12634
85 Ga0316181_1281095 3300030744 Bacteria 1047
86 Ga0307407_10206949 3300031903 Unclassified 1319
87 Ga0307412_10000237 3300031911 Bacteria 36026
88 Ga0307414_10000656 3300032004 Bacteria 17688
89 Ga0307414_10030144 3300032004 Bacteria 3541
90 Ga0307414_10036044 3300032004 Bacteria 3298
91 Ga0307411_10012652 3300032005 Bacteria 4616
92 Ga0307507_10002519 3300033179 Bacteria 38243
93 Ga0373955_0215659 3300035172 Bacteria 1145
94 Ga0395899_0000280 3300037312 Bacteria 66580
95 Ga0436363_0571220 3300039450 Bacteria 1006
96 Ga0439437_002191 3300042000 Bacteria 2078
97 Ga0450917_000390 3300042120 Bacteria 3302
98 Ga0450891_002086 3300042129 Bacteria 2031
99 Ga0450892_000504 3300042130 Bacteria 4527
100 Ga0450900_001843 3300042136 Bacteria 2151
101 Ga0450902_010876 3300042137 Bacteria 1441
102 Ga0450903_004375 3300042138 Bacteria 2414
103 Ga0450904_009379 3300042139 Bacteria 964
104 Ga0450889_000068 3300042144 Bacteria 9216
105 Ga0450893_0000582 3300042532 Bacteria 5213
106 Ga0453684_0563977 3300044712 Unclassified 1252
107 Ga0451576_0040389 3300045051 Bacteria 4939
108 Ga0495651_0167871 3300046462 Bacteria 1566
109 Ga0495650_0157681 3300046471 Unclassified 811
110 Ga0495580_0111886 3300046472 Unclassified 1896
111 Ga0495639_0008433 3300046475 Bacteria 4421
112 Ga0495585_0000330 3300046492 Bacteria 46311
113 Ga0495610_0003293 3300046512 Bacteria 12716
114 Ga0495648_0002046 3300046524 Bacteria 19132
115 Ga0495633_0000014 3300046558 Bacteria 261742
116 Ga0495633_0039244 3300046558 Bacteria 2260
117 Ga0495668_0000003 3300046616 Bacteria 695023
118 Ga0495625_0000669 3300046660 Bacteria 48864
119 Ga0495625_0003408 3300046660 Bacteria 15900
120 Ga0495625_0047193 3300046660 Bacteria 3106
121 Ga0495677_0206983 3300047445 Bacteria 763
122 Ga0495686_0000524 3300047472 Bacteria 55256
123 Ga0495614_0011357 3300048089 Bacteria 3920
124 Ga0496101_0265295 3300048904 Bacteria 1340
125 Ga0496111_0095714 3300048914 Bacteria 2179
126 Ga0496126_0048004 3300048929 Bacteria 3906
127 Ga0501048_0531517 3300049582 Bacteria 844
128 Ga0501073_0129620 3300049589 Unclassified 1748
129 Ga0501076_0038042 3300049592 Bacteria 3776
130 Ga0501076_0606747 3300049592 Bacteria 903
131 Ga0501080_0440614 3300049742 Bacteria 1169
132 Ga0501241_005242 3300049758 Bacteria 2419
133 nmdc:mga0k408_16_c2 3300050493 Bacteria 101089
134 nmdc:mga05p37_476_c1 3300050507 Bacteria 43712
135 nmdc:mga09592_115838_c1 3300050508 Unclassified 2300
136 nmdc:mga09592_187808_c1 3300050508 Bacteria 1788
137 nmdc:mga09592_284_c1 3300050508 Bacteria 36913
138 nmdc:mga0n895_609023_c1 3300050512 Unclassified 1094
139 nmdc:mga0a205_260782_c1 3300050515 Bacteria 1611
140 Ga0500646_0147551 3300053090 Bacteria 776
141 Ga0500583_0000138 3300053092 Bacteria 30714
142 Ga0500608_016495 3300053122 Bacteria 3338
143 Ga0501084_0243261 3300054114 Bacteria 1519
144 Ga0501084_0322521 3300054114 Bacteria 1305
145 Ga0501084_0332632 3300054114 Bacteria 1283
146 Ga0501082_0807491 3300060353 Unclassified 821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026142 Ga0207698_10616605 Ga0207698_106166051 168
2 3300048914 Ga0496111_0095714 Ga0496111_0095714_276_890 179
3 3300049582 Ga0501048_0531517 Ga0501048_0531517_266_826 186
4 3300005329 Ga0070683_100397187 Ga0070683_1003971872 191
5 3300025944 Ga0207661_10033382 Ga0207661_100333823 191
6 3300005546 Ga0070696_100471277 Ga0070696_1004712771 194
7 3300006852 Ga0075433_10168314 Ga0075433_101683143 194
8 3300009147 Ga0114129_10006829 Ga0114129_1000682917 194
9 3300030742 Ga0316183_1079280 Ga0316183_10792803 194
10 3300030744 Ga0316181_1155779 Ga0316181_11557794 194
11 3300050515 nmdc:mga0a205_260782_c1 nmdc:mga0a205_260782_c1_353_985 194
12 3300013100 Ga0157373_10007074 Ga0157373_100070748 197
13 3300013105 Ga0157369_10000047 Ga0157369_10000047150 197
14 3300015262 Ga0182007_10000005 Ga0182007_10000005248 197
15 iso_pu_bacteria 2513237165 2514041604 201
16 iso_pu_bacteria 644736347 644750875 201
17 3300046512 Ga0495610_0003293 Ga0495610_0003293_6919_7539 202
18 iso_pu_bacteria 2738543023 2739302618 203
19 iso_pu_bacteria 2739367651 2739587086 204
20 3300032004 Ga0307414_10030144 Ga0307414_100301442 205
21 3300032005 Ga0307411_10012652 Ga0307411_100126523 205
22 3300035172 Ga0373955_0215659 Ga0373955_0215659_45_662 205
23 3300042000 Ga0439437_002191 Ga0439437_002191_997_1614 205
24 3300042120 Ga0450917_000390 Ga0450917_000390_1056_1673 205
25 3300042129 Ga0450891_002086 Ga0450891_002086_450_1067 205
26 3300042130 Ga0450892_000504 Ga0450892_000504_1976_2593 205
27 3300042136 Ga0450900_001843 Ga0450900_001843_597_1214 205
28 3300042137 Ga0450902_010876 Ga0450902_010876_280_897 205
29 3300042138 Ga0450903_004375 Ga0450903_004375_482_1099 205
30 3300042139 Ga0450904_009379 Ga0450904_009379_273_890 205
31 3300042144 Ga0450889_000068 Ga0450889_000068_681_1298 205
32 3300042532 Ga0450893_0000582 Ga0450893_0000582_806_1423 205
33 3300046462 Ga0495651_0167871 Ga0495651_0167871_173_790 205
34 3300046475 Ga0495639_0008433 Ga0495639_0008433_2311_2928 205
35 iso_pu_bacteria 2524023207 2524454636 205
36 3300003323 rootH1_10002752 rootH1_100027523 207
37 3300003323 rootH1_10038638 rootH1_100386382 207
38 3300005288 Ga0065714_10014690 Ga0065714_100146902 207
39 3300005367 Ga0070667_100333722 Ga0070667_1003337222 207
40 3300005563 Ga0068855_100033925 Ga0068855_1000339255 207
41 3300005578 Ga0068854_100010430 Ga0068854_1000104303 207
42 3300006195 Ga0075366_10000041 Ga0075366_1000004121 207
43 3300009093 Ga0105240_10007062 Ga0105240_100070622 207
44 3300009545 Ga0105237_10002465 Ga0105237_100024658 207
45 3300009545 Ga0105237_10002626 Ga0105237_1000262611 207
46 3300009545 Ga0105237_10004143 Ga0105237_1000414311 207
47 3300010375 Ga0105239_10001267 Ga0105239_1000126718 207
48 3300010375 Ga0105239_10007161 Ga0105239_100071614 207
49 3300010375 Ga0105239_10043304 Ga0105239_100433043 207
50 3300013105 Ga0157369_10000301 Ga0157369_1000030141 207
51 3300013306 Ga0163162_10284809 Ga0163162_102848092 207
52 3300013306 Ga0163162_11148010 Ga0163162_111480101 207
53 3300013307 Ga0157372_10000037 Ga0157372_10000037108 207
54 3300017792 Ga0163161_10061772 Ga0163161_100617722 207
55 3300025233 Ga0209437_100119 Ga0209437_10011917 207
56 3300025913 Ga0207695_10023004 Ga0207695_100230048 207
57 3300025913 Ga0207695_10212684 Ga0207695_102126842 207
58 3300025914 Ga0207671_10001872 Ga0207671_1000187212 207
59 3300025914 Ga0207671_10003904 Ga0207671_100039047 207
60 3300025949 Ga0207667_10103029 Ga0207667_101030294 207
61 3300025981 Ga0207640_10008596 Ga0207640_100085963 207
62 3300025986 Ga0207658_10093572 Ga0207658_100935724 207
63 3300028794 Ga0307515_10009296 Ga0307515_1000929612 207
64 3300033179 Ga0307507_10002519 Ga0307507_100025194 207
65 3300037312 Ga0395899_0000280 Ga0395899_0000280_17538_18167 207
66 3300046471 Ga0495650_0157681 Ga0495650_0157681_71_697 207
67 3300046492 Ga0495585_0000330 Ga0495585_0000330_43323_43949 207
68 3300046524 Ga0495648_0002046 Ga0495648_0002046_5958_6584 207
69 3300046558 Ga0495633_0000014 Ga0495633_0000014_54980_55606 207
70 3300046616 Ga0495668_0000003 Ga0495668_0000003_302800_303426 207
71 3300046660 Ga0495625_0000669 Ga0495625_0000669_15037_15663 207
72 3300046660 Ga0495625_0003408 Ga0495625_0003408_11735_12361 207
73 3300046660 Ga0495625_0047193 Ga0495625_0047193_1274_1900 207
74 3300047445 Ga0495677_0206983 Ga0495677_0206983_57_683 207
75 3300047472 Ga0495686_0000524 Ga0495686_0000524_40625_41251 207
76 3300048089 Ga0495614_0011357 Ga0495614_0011357_741_1367 207
77 3300048904 Ga0496101_0265295 Ga0496101_0265295_156_785 207
78 3300048929 Ga0496126_0048004 Ga0496126_0048004_1014_1643 207
79 3300050493 nmdc:mga0k408_16_c2 nmdc:mga0k408_16_c2_56414_57040 207
80 2162886007 SwRhRL2b_contig_519107 SwRhRL2b_0013.00000460 208
81 3300005288 Ga0065714_10003470 Ga0065714_100034707 208
82 3300005288 Ga0065714_10090367 Ga0065714_100903672 208
83 3300005289 Ga0065704_10000223 Ga0065704_1000022396 208
84 3300005327 Ga0070658_10274138 Ga0070658_102741382 208
85 3300005329 Ga0070683_100016399 Ga0070683_1000163997 208
86 3300005344 Ga0070661_100048394 Ga0070661_1000483944 208
87 3300005354 Ga0070675_100331193 Ga0070675_1003311932 208
88 3300005355 Ga0070671_100134956 Ga0070671_1001349563 208
89 3300005364 Ga0070673_100542170 Ga0070673_1005421702 208
90 3300005564 Ga0070664_100012764 Ga0070664_1000127642 208
91 3300005616 Ga0068852_100163867 Ga0068852_1001638672 208
92 3300005843 Ga0068860_100004779 Ga0068860_10000477915 208
93 3300013100 Ga0157373_10000253 Ga0157373_1000025319 208
94 3300013102 Ga0157371_10000117 Ga0157371_10000117112 208
95 3300013102 Ga0157371_10003781 Ga0157371_100037819 208
96 3300013104 Ga0157370_10258560 Ga0157370_102585602 208
97 3300013306 Ga0163162_10001657 Ga0163162_1000165712 208
98 3300014497 Ga0182008_10000001 Ga0182008_10000001124 208
99 3300014968 Ga0157379_10523347 Ga0157379_105233472 208
100 3300015261 Ga0182006_1005403 Ga0182006_10054037 208
101 3300017792 Ga0163161_10006093 Ga0163161_100060933 208
102 3300025925 Ga0207650_10417898 Ga0207650_104178982 208
103 3300025926 Ga0207659_10399230 Ga0207659_103992302 208
104 3300025931 Ga0207644_10825064 Ga0207644_108250641 208
105 3300025944 Ga0207661_10051932 Ga0207661_100519322 208
106 3300025945 Ga0207679_10045293 Ga0207679_100452932 208
107 3300025945 Ga0207679_10266887 Ga0207679_102668871 208
108 3300026118 Ga0207675_101102082 Ga0207675_1011020821 208
109 3300026142 Ga0207698_10169612 Ga0207698_101696122 208
110 3300027543 Ga0209999_1020952 Ga0209999_10209522 208
111 3300027617 Ga0210002_1025134 Ga0210002_10251341 208
112 3300028381 Ga0268264_10003505 Ga0268264_100035053 208
113 3300030744 Ga0316181_1281095 Ga0316181_12810951 208
114 3300031911 Ga0307412_10000237 Ga0307412_1000023715 208
115 3300032004 Ga0307414_10000656 Ga0307414_100006567 208
116 3300032004 Ga0307414_10036044 Ga0307414_100360443 208
117 3300046472 Ga0495580_0111886 Ga0495580_0111886_1123_1752 208
118 3300046558 Ga0495633_0039244 Ga0495633_0039244_847_1479 208
119 3300049758 Ga0501241_005242 Ga0501241_005242_379_1011 208
120 3300053122 Ga0500608_016495 Ga0500608_016495_1797_2441 208
121 3300053090 Ga0500646_0147551 Ga0500646_0147551_12_647 209
122 3300053092 Ga0500583_0000138 Ga0500583_0000138_9877_10548 209
123 2162886007 SwRhRL2b_contig_310132 SwRhRL2b_0380.00007430 210
124 3300005289 Ga0065704_10070812 Ga0065704_100708126 210
125 3300005295 Ga0065707_10000483 Ga0065707_1000048352 210
126 3300005445 Ga0070708_100036998 Ga0070708_1000369981 210
127 3300005518 Ga0070699_100010700 Ga0070699_1000107006 210
128 3300006028 Ga0070717_10407912 Ga0070717_104079121 210
129 3300006880 Ga0075429_100000170 Ga0075429_10000017016 210
130 3300006880 Ga0075429_100337102 Ga0075429_1003371021 210
131 3300009147 Ga0114129_10000806 Ga0114129_1000080630 210
132 3300009147 Ga0114129_10300394 Ga0114129_103003942 210
133 3300009147 Ga0114129_11688022 Ga0114129_116880221 210
134 3300014326 Ga0157380_10398507 Ga0157380_103985072 210
135 3300031903 Ga0307407_10206949 Ga0307407_102069492 210
136 3300039450 Ga0436363_0571220 Ga0436363_0571220_199_840 210
137 3300044712 Ga0453684_0563977 Ga0453684_0563977_441_1073 210
138 3300045051 Ga0451576_0040389 Ga0451576_0040389_493_1125 210
139 3300049589 Ga0501073_0129620 Ga0501073_0129620_1063_1701 210
140 3300049592 Ga0501076_0038042 Ga0501076_0038042_494_1126 210
141 3300049592 Ga0501076_0606747 Ga0501076_0606747_87_719 210
142 3300049742 Ga0501080_0440614 Ga0501080_0440614_286_921 210
143 3300050507 nmdc:mga05p37_476_c1 nmdc:mga05p37_476_c1_29567_30199 210
144 3300050508 nmdc:mga09592_115838_c1 nmdc:mga09592_115838_c1_228_860 210
145 3300050508 nmdc:mga09592_187808_c1 nmdc:mga09592_187808_c1_740_1372 210
146 3300050508 nmdc:mga09592_284_c1 nmdc:mga09592_284_c1_31202_31834 210
147 3300050512 nmdc:mga0n895_609023_c1 nmdc:mga0n895_609023_c1_46_678 210
148 3300054114 Ga0501084_0243261 Ga0501084_0243261_106_738 210
149 3300054114 Ga0501084_0322521 Ga0501084_0322521_215_847 210
150 3300054114 Ga0501084_0332632 Ga0501084_0332632_42_677 210
151 3300060353 Ga0501082_0807491 Ga0501082_0807491_101_733 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

41

234

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.5109 3 206
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.4961 3 206
6ob6-assembly2.cif.gz_B human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4736 24 203
8e6l-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter d296a mutant in an inward-open, manganese-bound state 0.4556 13 204
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4324 4 205
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6184 37 203 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6024 37 203 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5468 4 203 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5234 4 203 1.20.1250.20
af_O13714_132_635_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.483 72 203 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4R0HGS8-F1-model_v4 LysE family translocator 0.9185 3 206 GO:0005886
GO:0015171
AF-A0A7S8C215-F1-model_v4 LysE family translocator 0.914 2 210 GO:0005886
GO:0015171
AF-A0A0A8XIS3-F1-model_v4 Putative homoserine/homoserine lactone efflux protein 0.9076 3 203 GO:0005886
GO:0015171
AF-A0A220VF28-F1-model_v4 Threonine transporter RhtB 0.9037 1 206 GO:0005886
GO:0042970
AF-A0A7Z2AGV9-F1-model_v4 deleted 0.902 3 203

Feature Viewer

pLDDT pTM Quality
83.32 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map