F208711

General Info

Members Datasets Scaffolds Average Seq Length
150 97 300 321

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10324885|Ga0105238_103248851
Length 349
Sequence MSLNAGLISHIAVSSTFIVLKNKVMQTQTHYTGIDISKSFFDVAVAEAHGYRYYKFDNNEAGFSALFKILPEGSVVVMEASGPYYLPLACYLSAKGIAVSVINPLVIRRFCQMRMSRAKTDKKDARMIAEYGHAEKPGLWQVPQEHVIALQQMETLLAGLHKEYTATSNQLESFTSSGMLDKRLEKLIKKELKHKQELIDQLTVEMEELAKKHYARMLADLESIPGMGRKTAMMLIVLSGGFSRFDDYRKLSSYIGLCPRIFESGTSVKGKARICKMGMSRIRAMLYLCSWSAKRCNKACRQLYERLIAKGKAKKLALIAVANKLLKQAFAIATSKTTYNENYIKNICF

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
71 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
83 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
96 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
97 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 4
Rhizoplane 0
Rhizosphere 84.67
Stem 0
Stem Tuber 0
Unclassified 13.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10324885 3300009551 Bacteria 1525
2 JGI24737J22298_10040793 3300001990 Bacteria 1424
3 JGI24735J21928_10023518 3300002067 Bacteria 1868
4 JGI24735J21928_10036067 3300002067 Bacteria 1451
5 JGI24735J21928_10044299 3300002067 Bacteria 1293
6 JGI25165J46597_1006616 3300003214 Bacteria 2033
7 JGI25165J46597_1010681 3300003214 Bacteria 1331
8 rootH1_10100796 3300003316 Bacteria 1914
9 rootH1_10122333 3300003316 Bacteria 2409
10 rootH2_10003621 3300003320 Unclassified 2060
11 rootH2_10006580 3300003320 Unclassified 1227
12 rootH2_10165466 3300003320 Bacteria 3018
13 rootL2_10145187 3300003322 Bacteria 1396
14 rootL2_10338927 3300003322 Unclassified 1176
15 rootH1_10054619 3300003323 Unclassified 1250
16 rootH1_10127867 3300003323 Bacteria 1224
17 rootH1_10258150 3300003323 Unclassified 2569
18 Ga0065714_10091709 3300005288 Bacteria 1901
19 Ga0065714_10122727 3300005288 Bacteria 1323
20 Ga0070658_10232785 3300005327 Bacteria 1560
21 Ga0070658_10281641 3300005327 Bacteria 1415
22 Ga0068869_100200732 3300005334 Bacteria 1572
23 Ga0068869_100241637 3300005334 Bacteria 1439
24 Ga0070666_10260006 3300005335 Bacteria 1230
25 Ga0070671_100170316 3300005355 Bacteria 1842
26 Ga0070674_100089344 3300005356 Bacteria 2219
27 Ga0070667_100408053 3300005367 Bacteria 1237
28 Ga0070681_10195950 3300005458 Bacteria 1939
29 Ga0068867_100289896 3300005459 Bacteria 1345
30 Ga0070684_100444930 3300005535 Bacteria 1197
31 Ga0068853_100360438 3300005539 Bacteria 1354
32 Ga0068853_100456417 3300005539 Bacteria 1202
33 Ga0068855_100125684 3300005563 Unclassified 2932
34 Ga0068855_100273983 3300005563 Bacteria 1876
35 Ga0068855_100382317 3300005563 Bacteria 1545
36 Ga0068855_100483132 3300005563 Bacteria 1348
37 Ga0068852_100029006 3300005616 Bacteria 4539
38 Ga0068852_100328921 3300005616 Bacteria 1486
39 Ga0068861_100123736 3300005719 Bacteria 2090
40 Ga0068851_10046697 3300005834 Bacteria 2191
41 Ga0068863_100469467 3300005841 Bacteria 1236
42 Ga0070716_100134924 3300006173 Bacteria 1566
43 Ga0097621_100103002 3300006237 Unclassified 2404
44 Ga0068865_100169522 3300006881 Bacteria 1672
45 Ga0079104_1016132 3300006946 Bacteria 2193
46 Ga0079104_1031194 3300006946 Bacteria 1323
47 Ga0079104_1038292 3300006946 Bacteria 1137
48 Ga0105240_10280919 3300009093 Bacteria 1912
49 Ga0105240_10297905 3300009093 Bacteria 1846
50 Ga0105240_10318753 3300009093 Bacteria 1773
51 Ga0105240_10580447 3300009093 Bacteria 1237
52 Ga0105240_10582040 3300009093 Bacteria 1235
53 Ga0105245_10290672 3300009098 Bacteria 1601
54 Ga0105243_10307385 3300009148 Bacteria 1439
55 Ga0105243_10390872 3300009148 Bacteria 1289
56 Ga0105243_10424348 3300009148 Bacteria 1241
57 Ga0105241_10062438 3300009174 Bacteria 2872
58 Ga0105241_10157631 3300009174 Unclassified 1863
59 Ga0105241_10199200 3300009174 Bacteria 1671
60 Ga0105241_10208444 3300009174 Bacteria 1636
61 Ga0105237_10169578 3300009545 Bacteria 2182
62 Ga0105237_10174955 3300009545 Bacteria 2147
63 Ga0105237_10194211 3300009545 Bacteria 2029
64 Ga0105238_10510684 3300009551 Bacteria 1204
65 Ga0105238_10515704 3300009551 Bacteria 1198
66 Ga0105249_10024775 3300009553 Bacteria 5395
67 Ga0105239_10609047 3300010375 Bacteria 1246
68 Ga0105246_10195050 3300011119 Bacteria 1570
69 Ga0157373_10194625 3300013100 Bacteria 1429
70 Ga0157370_10082387 3300013104 Bacteria 3026
71 Ga0157370_10336970 3300013104 Bacteria 1390
72 Ga0157370_10472196 3300013104 Bacteria 1153
73 Ga0157369_10181918 3300013105 Bacteria 2212
74 Ga0157374_10116622 3300013296 Bacteria 2573
75 Ga0157378_10253592 3300013297 Bacteria 1685
76 Ga0157378_10372388 3300013297 Bacteria 1400
77 Ga0163162_10000140 3300013306 Bacteria 65811
78 Ga0157372_10040340 3300013307 Bacteria 5156
79 Ga0157372_10791520 3300013307 Unclassified 1102
80 Ga0163163_10413166 3300014325 Bacteria 1408
81 Ga0157376_10031156 3300014969 Bacteria 4267
82 Ga0207427_105894 3300025231 Bacteria 1641
83 Ga0209233_1030406 3300025261 Bacteria 1272
84 Ga0207680_10247528 3300025903 Bacteria 1230
85 Ga0207647_10078236 3300025904 Bacteria 1987
86 Ga0207705_10183619 3300025909 Bacteria 1579
87 Ga0207654_10066691 3300025911 Unclassified 2124
88 Ga0207654_10093371 3300025911 Bacteria 1839
89 Ga0207654_10174113 3300025911 Bacteria 1400
90 Ga0207695_10081195 3300025913 Bacteria 3282
91 Ga0207695_10157430 3300025913 Bacteria 2206
92 Ga0207695_10248269 3300025913 Bacteria 1679
93 Ga0207695_10272986 3300025913 Bacteria 1586
94 Ga0207695_10288231 3300025913 Bacteria 1534
95 Ga0207671_10026002 3300025914 Bacteria 4391
96 Ga0207671_10034825 3300025914 Bacteria 3741
97 Ga0207671_10108001 3300025914 Bacteria 2115
98 Ga0207694_10342386 3300025924 Unclassified 1236
99 Ga0207687_10195115 3300025927 Bacteria 1579
100 Ga0207644_10135902 3300025931 Bacteria 1887
101 Ga0207709_10042463 3300025935 Unclassified 2735
102 Ga0207669_10018549 3300025937 Bacteria 3600
103 Ga0207704_10276233 3300025938 Bacteria 1275
104 Ga0207665_10234477 3300025939 Bacteria 1350
105 Ga0207689_10072043 3300025942 Bacteria 2839
106 Ga0207689_10192833 3300025942 Bacteria 1681
107 Ga0207667_10261126 3300025949 Bacteria 1771
108 Ga0207667_10471232 3300025949 Bacteria 1275
109 Ga0207667_10489590 3300025949 Bacteria 1248
110 Ga0207640_10172327 3300025981 Bacteria 1614
111 Ga0207640_10434004 3300025981 Unclassified 1078
112 Ga0207639_10325919 3300026041 Bacteria 1365
113 Ga0207639_10406269 3300026041 Bacteria 1228
114 Ga0207641_10000250 3300026088 Bacteria 68774
115 Ga0207648_10247758 3300026089 Bacteria 1588
116 Ga0207676_10433464 3300026095 Bacteria 1235
117 Ga0207675_100116374 3300026118 Bacteria 2526
118 Ga0207698_10058571 3300026142 Bacteria 2986
119 Ga0207698_10104431 3300026142 Bacteria 2357
120 Ga0209281_1000094 3300027111 Bacteria 238155
121 Ga0209281_1014414 3300027111 Bacteria 1674
122 Ga0209281_1024088 3300027111 Bacteria 1147
123 Ga0209973_1003686 3300027252 Bacteria 1525
124 Ga0209967_1007212 3300027364 Bacteria 1517
125 Ga0307416_100611263 3300032002 Bacteria 1171
126 Ga0307414_10019283 3300032004 Unclassified 4223
127 Ga0307415_100368747 3300032126 Bacteria 1215
128 Ga0373935_0232546 3300035692 Bacteria 1284
129 Ga0373937_0837420 3300036401 Bacteria 868
130 Ga0395899_0101910 3300037312 Bacteria 2071
131 Ga0395901_0412824 3300038443 Unclassified 1385
132 Ga0400484_39965 3300038725 Bacteria 3234
133 Ga0436361_1194553 3300039447 Unclassified 2080
134 Ga0450904_003863 3300042139 Bacteria 1586
135 Ga0450901_003884 3300042533 Bacteria 1551
136 Ga0451577_0150952 3300042876 Bacteria 2090
137 Ga0453684_0539317 3300044712 Unclassified 1286
138 Ga0495605_0048166 3300046474 Bacteria 2087
139 Ga0495606_0180669 3300046507 Bacteria 1216
140 Ga0495632_0055670 3300046519 Bacteria 1935
141 Ga0495632_0073090 3300046519 Unclassified 1645
142 Ga0495660_0054450 3300046810 Bacteria 2167
143 Ga0495687_003058 3300047443 Bacteria 12553
144 Ga0501040_0077629 3300049576 Unclassified 2297
145 Ga0501046_0051269 3300049580 Bacteria 3257
146 Ga0501080_0317278 3300049742 Unclassified 1411
147 Ga0501044_0343879 3300049823 Bacteria 1412
148 Ga0500607_114090 3300053121 Bacteria 1319
149 Ga0500559_0065628 3300053136 Bacteria 1626
150 2833642634 2833640130 Bacteria 4858325
151 Ga0105238_10324885
152 JGI24737J22298_10040793
153 JGI24735J21928_10023518
154 JGI24735J21928_10036067
155 JGI24735J21928_10044299
156 JGI25165J46597_1006616
157 JGI25165J46597_1010681
158 rootH1_10100796
159 rootH1_10122333
160 rootH2_10003621
161 rootH2_10006580
162 rootH2_10165466
163 rootL2_10145187
164 rootL2_10338927
165 rootH1_10054619
166 rootH1_10127867
167 rootH1_10258150
168 Ga0065714_10091709
169 Ga0065714_10122727
170 Ga0070658_10232785
171 Ga0070658_10281641
172 Ga0068869_100200732
173 Ga0068869_100241637
174 Ga0070666_10260006
175 Ga0070671_100170316
176 Ga0070674_100089344
177 Ga0070667_100408053
178 Ga0070681_10195950
179 Ga0068867_100289896
180 Ga0070684_100444930
181 Ga0068853_100360438
182 Ga0068853_100456417
183 Ga0068855_100125684
184 Ga0068855_100273983
185 Ga0068855_100382317
186 Ga0068855_100483132
187 Ga0068852_100029006
188 Ga0068852_100328921
189 Ga0068861_100123736
190 Ga0068851_10046697
191 Ga0068863_100469467
192 Ga0070716_100134924
193 Ga0097621_100103002
194 Ga0068865_100169522
195 Ga0079104_1016132
196 Ga0079104_1031194
197 Ga0079104_1038292
198 Ga0105240_10280919
199 Ga0105240_10297905
200 Ga0105240_10318753
201 Ga0105240_10580447
202 Ga0105240_10582040
203 Ga0105245_10290672
204 Ga0105243_10307385
205 Ga0105243_10390872
206 Ga0105243_10424348
207 Ga0105241_10062438
208 Ga0105241_10157631
209 Ga0105241_10199200
210 Ga0105241_10208444
211 Ga0105237_10169578
212 Ga0105237_10174955
213 Ga0105237_10194211
214 Ga0105238_10510684
215 Ga0105238_10515704
216 Ga0105249_10024775
217 Ga0105239_10609047
218 Ga0105246_10195050
219 Ga0157373_10194625
220 Ga0157370_10082387
221 Ga0157370_10336970
222 Ga0157370_10472196
223 Ga0157369_10181918
224 Ga0157374_10116622
225 Ga0157378_10253592
226 Ga0157378_10372388
227 Ga0163162_10000140
228 Ga0157372_10040340
229 Ga0157372_10791520
230 Ga0163163_10413166
231 Ga0157376_10031156
232 Ga0207427_105894
233 Ga0209233_1030406
234 Ga0207680_10247528
235 Ga0207647_10078236
236 Ga0207705_10183619
237 Ga0207654_10066691
238 Ga0207654_10093371
239 Ga0207654_10174113
240 Ga0207695_10081195
241 Ga0207695_10157430
242 Ga0207695_10248269
243 Ga0207695_10272986
244 Ga0207695_10288231
245 Ga0207671_10026002
246 Ga0207671_10034825
247 Ga0207671_10108001
248 Ga0207694_10342386
249 Ga0207687_10195115
250 Ga0207644_10135902
251 Ga0207709_10042463
252 Ga0207669_10018549
253 Ga0207704_10276233
254 Ga0207665_10234477
255 Ga0207689_10072043
256 Ga0207689_10192833
257 Ga0207667_10261126
258 Ga0207667_10471232
259 Ga0207667_10489590
260 Ga0207640_10172327
261 Ga0207640_10434004
262 Ga0207639_10325919
263 Ga0207639_10406269
264 Ga0207641_10000250
265 Ga0207648_10247758
266 Ga0207676_10433464
267 Ga0207675_100116374
268 Ga0207698_10058571
269 Ga0207698_10104431
270 Ga0209281_1000094
271 Ga0209281_1014414
272 Ga0209281_1024088
273 Ga0209973_1003686
274 Ga0209967_1007212
275 Ga0307416_100611263
276 Ga0307414_10019283
277 Ga0307415_100368747
278 Ga0373935_0232546
279 Ga0373937_0837420
280 Ga0395899_0101910
281 Ga0395901_0412824
282 Ga0400484_39965
283 Ga0436361_1194553
284 Ga0450904_003863
285 Ga0450901_003884
286 Ga0451577_0150952
287 Ga0453684_0539317
288 Ga0495605_0048166
289 Ga0495606_0180669
290 Ga0495632_0055670
291 Ga0495632_0073090
292 Ga0495660_0054450
293 Ga0495687_003058
294 Ga0501040_0077629
295 Ga0501046_0051269
296 Ga0501080_0317278
297 Ga0501044_0343879
298 Ga0500607_114090
299 Ga0500559_0065628
300 2833642634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02371

Transposase_20

Transposase IS116/IS110/IS902 family

218

305

0.97

PF01548

DEDD_Tnp_IS110

Transposase

32

179

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j0k-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.9719 122 188
8cwy-assembly1.cif.gz_H accurate computational design of genetically encoded 3d protein crystals 0.9653 122 188
8cwy-assembly1.cif.gz_R accurate computational design of genetically encoded 3d protein crystals 0.9651 122 188
8cwy-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.965 122 188
5j0k-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.9648 122 188
ID Description Score Start End Superfamily
2q0oD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.9128 122 187 1.10.287.160
2h94A03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.906 122 188 1.10.287.80
af_Q498T3_2_102_1.20.81.10 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain 0.8906 122 191 1.20.81.10
3hr0B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8901 122 188 1.10.287.1060
3hr0A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8898 122 188 1.10.287.1060
ID Description Score Start End GO Terms
AF-A0A4Y1YIT7-F1-model_v4 Transposase IS110-like N-terminal domain-containing protein 0.9723 7 117 GO:0003677
GO:0004803
GO:0006313
AF-A0A2V4X458-F1-model_v4 Transposase 0.9563 1 109 GO:0003677
GO:0004803
GO:0006313
AF-A0A1H3N1J9-F1-model_v4 Transposase 0.9561 7 118 GO:0003677
GO:0004803
GO:0006313
AF-A0A7X9J8L2-F1-model_v4 IS110 family transposase 0.9429 4 127 GO:0003677
GO:0004803
GO:0006313
AF-A0A3Y9I7L3-F1-model_v4 IS110 family transposase 0.9398 7 117 GO:0003677
GO:0004803
GO:0006313

Map