F208070

General Info

Members Datasets Scaffolds Average Seq Length
150 115 148 189

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10205226|Ga0070709_102052262
Length 201
Sequence MLREIRPAIVMILVMTVLTGLLYPLAMTGIAQLAFPHQARGSLIEKDGKVIGSALLGQNFEKPEYFHGRPSATTDTDPKDSSKTVPAPYNAANSSGSNAGPTSKALIERVQADVDKLKAENPNTPVPIDLVTTSASGLDPDISPAAAMFQVPRVAKARGIDEGQVRRLVQLHSEIRTFGILGEPRVNVLQLNMALDALKPG

Samples

Sample ID Description Type Environment
1 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
2 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
33 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
46 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
47 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
48 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
53 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
54 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
55 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
56 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
57 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
58 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
59 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
60 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
61 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
62 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
63 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
113 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
114 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
115 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 1.33
Rhizoplane 2.67
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 4.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100504773 3300005336 Bacteria 1035
2 Ga0070709_10205226 3300005434 Bacteria 1398
3 Ga0070713_100341261 3300005436 Bacteria 1388
4 Ga0070710_10332440 3300005437 Bacteria 1001
5 Ga0070711_100067794 3300005439 Bacteria 2505
6 Ga0070694_100002384 3300005444 Bacteria 11104
7 Ga0070708_100420766 3300005445 Bacteria 1260
8 Ga0070698_100374724 3300005471 Bacteria 1356
9 Ga0070695_100219853 3300005545 Bacteria 1368
10 Ga0070696_100159277 3300005546 Bacteria 1662
11 Ga0070696_100207338 3300005546 Bacteria 1466
12 Ga0068858_100652046 3300005842 Bacteria 1023
13 Ga0068860_100040029 3300005843 Bacteria 4481
14 Ga0081455_10023685 3300005937 Bacteria 5707
15 Ga0081455_10047707 3300005937 Bacteria 3707
16 Ga0081538_10016797 3300005981 Bacteria 5589
17 Ga0081538_10242829 3300005981 Bacteria 693
18 Ga0081539_10048461 3300005985 Bacteria 2417
19 Ga0070716_100329548 3300006173 Bacteria 1073
20 Ga0070716_100494621 3300006173 Bacteria 901
21 Ga0068871_100139090 3300006358 Bacteria 2063
22 Ga0075428_100020737 3300006844 Bacteria 7275
23 Ga0075428_100065630 3300006844 Bacteria 3975
24 Ga0075428_100165536 3300006844 Bacteria 2399
25 Ga0075430_100113296 3300006846 Bacteria 2261
26 Ga0075434_100025822 3300006871 Bacteria 5750
27 Ga0075434_100698232 3300006871 Bacteria 1032
28 Ga0075429_100605961 3300006880 Bacteria 960
29 Ga0075429_100800781 3300006880 Bacteria 825
30 Ga0075435_100041968 3300007076 Bacteria 3658
31 Ga0099794_10034317 3300007265 Bacteria 2389
32 Ga0099794_10082243 3300007265 Bacteria 1589
33 Ga0111539_10493497 3300009094 Bacteria 1426
34 Ga0105245_10724639 3300009098 Bacteria 1029
35 Ga0114129_10041427 3300009147 Bacteria 6489
36 Ga0114129_10131395 3300009147 Bacteria 3438
37 Ga0114129_10219670 3300009147 Bacteria 2564
38 Ga0114129_10599188 3300009147 Bacteria 1428
39 Ga0114129_11399449 3300009147 Bacteria 863
40 Ga0105242_10656229 3300009176 Bacteria 1021
41 Ga0157373_10148240 3300013100 Bacteria 1651
42 Ga0157375_10543247 3300013308 Bacteria 1324
43 Ga0209758_1004348 3300025297 Bacteria 11866
44 Ga0207696_1048067 3300025711 Bacteria 1228
45 Ga0207692_10232717 3300025898 Bacteria 1097
46 Ga0207692_10316642 3300025898 Bacteria 954
47 Ga0207699_10343240 3300025906 Bacteria 1052
48 Ga0207663_10060538 3300025916 Bacteria 2400
49 Ga0207660_10385870 3300025917 Bacteria 1126
50 Ga0207659_10782123 3300025926 Bacteria 820
51 Ga0207700_10023667 3300025928 Bacteria 4241
52 Ga0207700_10538569 3300025928 Bacteria 1035
53 Ga0207711_10000109 3300025941 Bacteria 85958
54 Ga0207703_10545078 3300026035 Bacteria 1093
55 Ga0209588_1000637 3300027671 Bacteria 8853
56 Ga0209588_1024026 3300027671 Bacteria 1924
57 Ga0209588_1084000 3300027671 Bacteria 1028
58 Ga0268265_11309988 3300028380 Bacteria 725
59 Ga0265337_1001377 3300028556 Bacteria 11960
60 Ga0265330_10085274 3300031235 Bacteria 1358
61 Ga0265332_10064839 3300031238 Bacteria 1560
62 Ga0265340_10056776 3300031247 Bacteria 1883
63 Ga0265340_10074611 3300031247 Bacteria 1603
64 Ga0265339_10117880 3300031249 Bacteria 1367
65 Ga0265316_10236646 3300031344 Bacteria 1343
66 Ga0265316_10245774 3300031344 Bacteria 1315
67 Ga0307508_10131542 3300031616 Bacteria 2106
68 Ga0265314_10138295 3300031711 Bacteria 1510
69 Ga0307516_10144191 3300031730 Bacteria 2148
70 Ga0307516_10155118 3300031730 Bacteria 2045
71 Ga0373949_0019259 3300035090 Bacteria 1553
72 Ga0373932_0003857 3300035112 Bacteria 3576
73 Ga0373939_0003830 3300035114 Bacteria 3544
74 Ga0373953_0088005 3300035117 Bacteria 1297
75 Ga0373953_0096789 3300035117 Bacteria 1239
76 Ga0373954_0204662 3300035118 Bacteria 970
77 Ga0373960_0071569 3300035121 Bacteria 1073
78 Ga0373943_0203614 3300035170 Bacteria 1096
79 Ga0373955_0365799 3300035172 Bacteria 874
80 Ga0373961_0031683 3300035241 Bacteria 1478
81 Ga0373962_0014794 3300035242 Bacteria 1992
82 Ga0373924_0060488 3300035410 Bacteria 1584
83 Ga0373924_0105279 3300035410 Bacteria 1216
84 Ga0373931_0001970 3300035691 Bacteria 9029
85 Ga0373927_0185974 3300035695 Bacteria 1363
86 Ga0373927_0201317 3300035695 Bacteria 1307
87 Ga0373933_0100891 3300035724 Bacteria 1791
88 Ga0373947_0339695 3300035725 Bacteria 1006
89 Ga0373937_0000983 3300036401 Bacteria 24176
90 Ga0373937_0043635 3300036401 Bacteria 4094
91 Ga0373925_0722943 3300037068 Bacteria 821
92 Ga0395899_0018289 3300037312 Bacteria 5329
93 Ga0395900_0008928 3300037418 Bacteria 10283
94 Ga0395900_0020359 3300037418 Bacteria 6772
95 Ga0436364_0528284 3300037853 Bacteria 829
96 Ga0395901_0002048 3300038443 Bacteria 20663
97 Ga0436363_0522396 3300039450 Bacteria 741
98 Ga0436362_0599915 3300039453 Bacteria 622
99 Ga0436362_0698494 3300039453 Bacteria 1163
100 Ga0466957_0162370 3300044842 Bacteria 1452
101 Ga0451576_1179953 3300045051 Bacteria 800
102 Ga0495638_0250582 3300046460 Unclassified 976
103 Ga0495639_0132028 3300046475 Bacteria 1196
104 Ga0495664_0381457 3300046477 Bacteria 847
105 Ga0495608_0119617 3300046511 Bacteria 1690
106 Ga0495630_0156148 3300046517 Bacteria 1737
107 Ga0495666_0207967 3300046526 Bacteria 898
108 Ga0495640_0309834 3300046533 Bacteria 979
109 Ga0495657_0265561 3300046675 Bacteria 1030
110 Ga0495613_0323652 3300046689 Bacteria 1064
111 Ga0495604_0128515 3300047317 Bacteria 1824
112 Ga0495676_0215408 3300047321 Bacteria 1326
113 Ga0496100_0782955 3300048903 Bacteria 747
114 Ga0496103_0043073 3300048906 Bacteria 2778
115 Ga0496107_0022713 3300048910 Bacteria 4435
116 Ga0496114_0228337 3300048917 Bacteria 1635
117 Ga0496119_0083547 3300048922 Bacteria 1833
118 Ga0496120_0019159 3300048923 Bacteria 4386
119 Ga0501040_0698614 3300049576 Bacteria 734
120 Ga0501042_0703344 3300049578 Bacteria 735
121 Ga0501047_0185130 3300049581 Bacteria 1948
122 Ga0501070_0010738 3300049586 Bacteria 7738
123 Ga0501074_0049587 3300049590 Bacteria 3032
124 Ga0501076_0099030 3300049592 Bacteria 2349
125 Ga0501079_0257915 3300049741 Bacteria 1363
126 Ga0501080_0774398 3300049742 Bacteria 843
127 Ga0501080_0991575 3300049742 Bacteria 729
128 Ga0501044_0016040 3300049823 Bacteria 8057
129 nmdc:mga05p37_159077_c1 3300050507 Bacteria 2759
130 nmdc:mga05p37_336594_c1 3300050507 Bacteria 1781
131 nmdc:mga05p37_536872_c1 3300050507 Bacteria 1334
132 nmdc:mga05p37_74113_c1 3300050507 Bacteria 4190
133 nmdc:mga05p37_78699_c1 3300050507 Bacteria 4060
134 nmdc:mga09592_214892_c1 3300050508 Bacteria 1666
135 nmdc:mga09592_226815_c1 3300050508 Bacteria 1618
136 nmdc:mga09592_640598_c1 3300050508 Bacteria 908
137 nmdc:mga0qj67_151380_c1 3300050509 Bacteria 1882
138 nmdc:mga06r32_332692_c1 3300050510 Bacteria 1504
139 nmdc:mga08y16_160847_c1 3300050511 Bacteria 2333
140 nmdc:mga0n895_1536825_c1 3300050512 Bacteria 631
141 nmdc:mga0n895_581487_c1 3300050512 Bacteria 1124
142 nmdc:mga0rr50_33755_c1 3300050513 Bacteria 3658
143 Ga0495619_0057822 3300053085 Bacteria 2573
144 Ga0495619_0226126 3300053085 Bacteria 1296
145 Ga0500644_0057771 3300053088 Bacteria 1355
146 Ga0500641_0001966 3300053096 Bacteria 7295
147 Ga0500595_038104 3300053119 Bacteria 1564
148 Ga0500616_0100456 3300053153 Bacteria 1415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10493497 Ga0111539_104934972 156
2 3300049581 Ga0501047_0185130 Ga0501047_0185130_14_493 156
3 3300050512 nmdc:mga0n895_1536825_c1 nmdc:mga0n895_1536825_c1_127_606 156
4 3300006844 Ga0075428_100165536 Ga0075428_1001655362 161
5 3300050508 nmdc:mga09592_214892_c1 nmdc:mga09592_214892_c1_1023_1604 161
6 3300005444 Ga0070694_100002384 Ga0070694_10000238415 162
7 3300005545 Ga0070695_100219853 Ga0070695_1002198532 162
8 3300005546 Ga0070696_100207338 Ga0070696_1002073381 162
9 3300049742 Ga0501080_0774398 Ga0501080_0774398_220_777 162
10 3300009147 Ga0114129_10131395 Ga0114129_101313952 164
11 3300049578 Ga0501042_0703344 Ga0501042_0703344_46_633 164
12 3300049590 Ga0501074_0049587 Ga0501074_0049587_20_607 164
13 3300049592 Ga0501076_0099030 Ga0501076_0099030_72_659 164
14 3300050507 nmdc:mga05p37_74113_c1 nmdc:mga05p37_74113_c1_2865_3446 164
15 3300048917 Ga0496114_0228337 Ga0496114_0228337_499_1080 165
16 3300005471 Ga0070698_100374724 Ga0070698_1003747242 166
17 3300009098 Ga0105245_10724639 Ga0105245_107246392 169
18 3300048903 Ga0496100_0782955 Ga0496100_0782955_64_669 169
19 3300026035 Ga0207703_10545078 Ga0207703_105450782 172
20 3300006844 Ga0075428_100065630 Ga0075428_1000656302 174
21 3300006880 Ga0075429_100605961 Ga0075429_1006059612 174
22 3300009147 Ga0114129_10041427 Ga0114129_100414272 174
23 3300031344 Ga0265316_10236646 Ga0265316_102366462 174
24 3300039453 Ga0436362_0599915 Ga0436362_0599915_68_595 174
25 3300046526 Ga0495666_0207967 Ga0495666_0207967_12_539 174
26 3300050507 nmdc:mga05p37_78699_c1 nmdc:mga05p37_78699_c1_3107_3688 174
27 3300050508 nmdc:mga09592_226815_c1 nmdc:mga09592_226815_c1_430_1011 174
28 3300031344 Ga0265316_10245774 Ga0265316_102457742 176
29 3300031711 Ga0265314_10138295 Ga0265314_101382952 176
30 3300049742 Ga0501080_0991575 Ga0501080_0991575_137_691 176
31 3300031249 Ga0265339_10117880 Ga0265339_101178802 177
32 3300007076 Ga0075435_100041968 Ga0075435_1000419685 178
33 3300009147 Ga0114129_10599188 Ga0114129_105991882 178
34 3300046475 Ga0495639_0132028 Ga0495639_0132028_257_862 178
35 3300046689 Ga0495613_0323652 Ga0495613_0323652_91_696 178
36 3300048906 Ga0496103_0043073 Ga0496103_0043073_289_894 178
37 3300049576 Ga0501040_0698614 Ga0501040_0698614_22_582 178
38 3300050511 nmdc:mga08y16_160847_c1 nmdc:mga08y16_160847_c1_15_560 178
39 3300050513 nmdc:mga0rr50_33755_c1 nmdc:mga0rr50_33755_c1_2880_3452 178
40 3300035170 Ga0373943_0203614 Ga0373943_0203614_142_747 179
41 3300035695 Ga0373927_0201317 Ga0373927_0201317_326_931 179
42 3300035725 Ga0373947_0339695 Ga0373947_0339695_348_953 179
43 3300050507 nmdc:mga05p37_536872_c1 nmdc:mga05p37_536872_c1_357_962 179
44 3300006871 Ga0075434_100025822 Ga0075434_1000258222 180
45 3300050512 nmdc:mga0n895_581487_c1 nmdc:mga0n895_581487_c1_479_1051 180
46 3300037853 Ga0436364_0528284 Ga0436364_0528284_204_803 181
47 3300005937 Ga0081455_10023685 Ga0081455_100236856 182
48 3300005985 Ga0081539_10048461 Ga0081539_100484612 182
49 iso_pu_bacteria 2977942078 2977945085 183
50 3300025711 Ga0207696_1048067 Ga0207696_10480672 184
51 3300025926 Ga0207659_10782123 Ga0207659_107821231 185
52 3300005842 Ga0068858_100652046 Ga0068858_1006520462 186
53 3300046460 Ga0495638_0250582 Ga0495638_0250582_218_778 186
54 3300048922 Ga0496119_0083547 Ga0496119_0083547_863_1426 186
55 3300049586 Ga0501070_0010738 Ga0501070_0010738_4130_4783 186
56 3300053153 Ga0500616_0100456 Ga0500616_0100456_602_1180 186
57 3300045051 Ga0451576_1179953 Ga0451576_1179953_172_741 187
58 3300005445 Ga0070708_100420766 Ga0070708_1004207661 188
59 3300005546 Ga0070696_100159277 Ga0070696_1001592771 188
60 3300005843 Ga0068860_100040029 Ga0068860_1000400294 188
61 3300005937 Ga0081455_10047707 Ga0081455_100477073 188
62 3300005981 Ga0081538_10016797 Ga0081538_100167975 188
63 3300005981 Ga0081538_10242829 Ga0081538_102428291 188
64 3300006173 Ga0070716_100329548 Ga0070716_1003295482 188
65 3300006358 Ga0068871_100139090 Ga0068871_1001390902 188
66 3300006871 Ga0075434_100698232 Ga0075434_1006982322 188
67 3300007265 Ga0099794_10034317 Ga0099794_100343172 188
68 3300007265 Ga0099794_10082243 Ga0099794_100822433 188
69 3300009147 Ga0114129_11399449 Ga0114129_113994492 188
70 3300009176 Ga0105242_10656229 Ga0105242_106562292 188
71 3300013100 Ga0157373_10148240 Ga0157373_101482402 188
72 3300025941 Ga0207711_10000109 Ga0207711_100001093 188
73 3300027671 Ga0209588_1000637 Ga0209588_10006373 188
74 3300027671 Ga0209588_1024026 Ga0209588_10240262 188
75 3300027671 Ga0209588_1084000 Ga0209588_10840002 188
76 3300028380 Ga0268265_11309988 Ga0268265_113099881 188
77 3300031235 Ga0265330_10085274 Ga0265330_100852742 188
78 3300031247 Ga0265340_10074611 Ga0265340_100746112 188
79 3300031730 Ga0307516_10155118 Ga0307516_101551182 188
80 3300039450 Ga0436363_0522396 Ga0436363_0522396_106_711 188
81 3300039453 Ga0436362_0698494 Ga0436362_0698494_358_960 188
82 3300044842 Ga0466957_0162370 Ga0466957_0162370_108_695 188
83 3300050507 nmdc:mga05p37_159077_c1 nmdc:mga05p37_159077_c1_470_1057 188
84 3300053088 Ga0500644_0057771 Ga0500644_0057771_468_1034 188
85 3300053119 Ga0500595_038104 Ga0500595_038104_519_1085 188
86 3300035117 Ga0373953_0096789 Ga0373953_0096789_583_1152 189
87 3300035118 Ga0373954_0204662 Ga0373954_0204662_217_786 189
88 3300035410 Ga0373924_0060488 Ga0373924_0060488_528_1097 189
89 3300036401 Ga0373937_0043635 Ga0373937_0043635_2599_3168 189
90 3300046675 Ga0495657_0265561 Ga0495657_0265561_202_771 189
91 3300047321 Ga0495676_0215408 Ga0495676_0215408_732_1304 189
92 3300053096 Ga0500641_0001966 Ga0500641_0001966_6606_7208 189
93 3300035695 Ga0373927_0185974 Ga0373927_0185974_16_591 190
94 3300013308 Ga0157375_10543247 Ga0157375_105432472 191
95 3300028556 Ga0265337_1001377 Ga0265337_10013776 194
96 3300031238 Ga0265332_10064839 Ga0265332_100648392 194
97 3300035172 Ga0373955_0365799 Ga0373955_0365799_152_757 194
98 3300035410 Ga0373924_0105279 Ga0373924_0105279_486_1091 194
99 3300035724 Ga0373933_0100891 Ga0373933_0100891_566_1171 194
100 3300036401 Ga0373937_0000983 Ga0373937_0000983_19457_20062 194
101 3300046477 Ga0495664_0381457 Ga0495664_0381457_35_640 194
102 3300046517 Ga0495630_0156148 Ga0495630_0156148_569_1174 194
103 3300046533 Ga0495640_0309834 Ga0495640_0309834_281_886 194
104 iso_pu_bacteria 2841957949 2841962061 196
105 3300049823 Ga0501044_0016040 Ga0501044_0016040_1635_2234 198
106 3300035117 Ga0373953_0088005 Ga0373953_0088005_311_910 199
107 3300046511 Ga0495608_0119617 Ga0495608_0119617_306_905 199
108 3300047317 Ga0495604_0128515 Ga0495604_0128515_1192_1791 199
109 3300053085 Ga0495619_0057822 Ga0495619_0057822_915_1514 199
110 3300053085 Ga0495619_0226126 Ga0495619_0226126_598_1197 199
111 3300005336 Ga0070680_100504773 Ga0070680_1005047731 200
112 3300005434 Ga0070709_10205226 Ga0070709_102052262 200
113 3300005436 Ga0070713_100341261 Ga0070713_1003412612 200
114 3300005437 Ga0070710_10332440 Ga0070710_103324402 200
115 3300005439 Ga0070711_100067794 Ga0070711_1000677941 200
116 3300006173 Ga0070716_100494621 Ga0070716_1004946211 200
117 3300006844 Ga0075428_100020737 Ga0075428_1000207372 200
118 3300006846 Ga0075430_100113296 Ga0075430_1001132962 200
119 3300006880 Ga0075429_100800781 Ga0075429_1008007811 200
120 3300009147 Ga0114129_10219670 Ga0114129_102196702 200
121 3300025297 Ga0209758_1004348 Ga0209758_10043481 200
122 3300025898 Ga0207692_10232717 Ga0207692_102327172 200
123 3300025898 Ga0207692_10316642 Ga0207692_103166422 200
124 3300025906 Ga0207699_10343240 Ga0207699_103432402 200
125 3300025916 Ga0207663_10060538 Ga0207663_100605382 200
126 3300025917 Ga0207660_10385870 Ga0207660_103858702 200
127 3300025928 Ga0207700_10023667 Ga0207700_100236672 200
128 3300025928 Ga0207700_10538569 Ga0207700_105385692 200
129 3300031247 Ga0265340_10056776 Ga0265340_100567762 200
130 3300031616 Ga0307508_10131542 Ga0307508_101315422 200
131 3300031730 Ga0307516_10144191 Ga0307516_101441912 200
132 3300035090 Ga0373949_0019259 Ga0373949_0019259_695_1300 200
133 3300035112 Ga0373932_0003857 Ga0373932_0003857_2549_3154 200
134 3300035114 Ga0373939_0003830 Ga0373939_0003830_859_1464 200
135 3300035121 Ga0373960_0071569 Ga0373960_0071569_165_770 200
136 3300035241 Ga0373961_0031683 Ga0373961_0031683_696_1301 200
137 3300035242 Ga0373962_0014794 Ga0373962_0014794_1282_1887 200
138 3300035691 Ga0373931_0001970 Ga0373931_0001970_5443_6048 200
139 3300037068 Ga0373925_0722943 Ga0373925_0722943_32_637 200
140 3300037312 Ga0395899_0018289 Ga0395899_0018289_4354_4959 200
141 3300037418 Ga0395900_0008928 Ga0395900_0008928_3482_4087 200
142 3300037418 Ga0395900_0020359 Ga0395900_0020359_1951_2556 200
143 3300038443 Ga0395901_0002048 Ga0395901_0002048_7876_8481 200
144 3300048910 Ga0496107_0022713 Ga0496107_0022713_3553_4158 200
145 3300048923 Ga0496120_0019159 Ga0496120_0019159_268_873 200
146 3300049741 Ga0501079_0257915 Ga0501079_0257915_580_1185 200
147 3300050507 nmdc:mga05p37_336594_c1 nmdc:mga05p37_336594_c1_933_1538 200
148 3300050508 nmdc:mga09592_640598_c1 nmdc:mga09592_640598_c1_196_801 200
149 3300050509 nmdc:mga0qj67_151380_c1 nmdc:mga0qj67_151380_c1_953_1558 200
150 3300050510 nmdc:mga06r32_332692_c1 nmdc:mga06r32_332692_c1_598_1203 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

5

197

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.8668 6 197
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.8499 6 197
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.8441 5 197
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.8196 5 197
1kcy-assembly1.cif.gz_A nmr solution structure of apo calbindin d9k (f36g + p43m mutant) 0.51 106 196
ID Description Score Start End Superfamily
af_Q06490_24_336_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.5772 143 171 3.40.1190.20
1kcyA00 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.51 106 196 1.10.238.10
1kcyA00 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4831 106 196 1.10.238.10
af_F1LX07_68_238_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4778 106 195 1.10.238.10
af_Q8ILL9_559_724_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4447 108 196 1.10.238.10
ID Description Score Start End GO Terms
AF-A0A536ZNA7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9708 122 196 GO:0005524
GO:0005886
GO:0008556
AF-I3E0A1-F1-model_v4 Potassium-transporting ATPase C chain 0.9706 125 197 GO:0005524
GO:0005886
GO:0008556
AF-A0A5J4KYI9-F1-model_v4 Potassium-transporting ATPase subunit C 0.9705 159 197 GO:0008556
GO:0016020
AF-A0A8B3G858-F1-model_v4 deleted 0.9606 141 196
AF-Q8VTB5-F1-model_v4 FrrA 0.9582 138 197 GO:0005524
GO:0005886
GO:0008556

Feature Viewer

pLDDT pTM Quality
82.75 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map