F207360

General Info

Members Datasets Scaffolds Average Seq Length
149 115 298 157

Family's Representative Sequence

Representative Sequence 3300053161|Ga0500634_0048981|Ga0500634_0048981_1496_2068
Length 190
Sequence LLDTGFTQSYLGLTSKILHKALGNKKRITTIRSEPMSQQEFRTLIGSLTAELAGRSLDSDLDRWLNTEHGAGSATFNSLTQACTRGVAEGWMCEREHGGIRYGRVCKAGDDLHGFSVDVVDMSDIAGPHHTHPLGEIDLIMPVDGSATFDGRPAGWCVYPPGSAHRPTVASGRALVLYLLPQGAIEFTRT

Samples

Sample ID Description Type Environment
1 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
73 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
84 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
85 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
108 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
111 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
112 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
115 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0.67
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.11
Nodule 0
Rhizoplane 0
Rhizosphere 75.84
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500634_0048981 3300053161 Bacteria 2279
2 Ga0070676_10406866 3300005328 Bacteria 948
3 Ga0068869_100046343 3300005334 Bacteria 3135
4 Ga0068869_100329756 3300005334 Bacteria 1240
5 Ga0070666_10137361 3300005335 Bacteria 1701
6 Ga0070666_10230702 3300005335 Bacteria 1307
7 Ga0070666_10697918 3300005335 Bacteria 744
8 Ga0068868_101490189 3300005338 Bacteria 633
9 Ga0070668_101291455 3300005347 Bacteria 663
10 Ga0070675_100480863 3300005354 Bacteria 1117
11 Ga0070671_100034738 3300005355 Bacteria 4174
12 Ga0070671_100428911 3300005355 Bacteria 1133
13 Ga0070673_100547315 3300005364 Bacteria 1051
14 Ga0070659_100284455 3300005366 Bacteria 1376
15 Ga0070667_100849672 3300005367 Bacteria 848
16 Ga0070663_100035058 3300005455 Bacteria 3479
17 Ga0070662_100184430 3300005457 Bacteria 1647
18 Ga0068867_100181149 3300005459 Bacteria 1675
19 Ga0070698_100856755 3300005471 Bacteria 854
20 Ga0070699_100446111 3300005518 Bacteria 1173
21 Ga0068853_101262395 3300005539 Bacteria 714
22 Ga0070665_100010086 3300005548 Bacteria 9559
23 Ga0070665_102010714 3300005548 Bacteria 583
24 Ga0068855_100295777 3300005563 Bacteria 1794
25 Ga0068857_100276949 3300005577 Bacteria 1542
26 Ga0068852_100095711 3300005616 Bacteria 2667
27 Ga0068859_100814619 3300005617 Bacteria 1021
28 Ga0068858_100649182 3300005842 Bacteria 1025
29 Ga0068860_100091698 3300005843 Bacteria 2895
30 Ga0075365_10298732 3300006038 Bacteria 1133
31 Ga0075368_10065279 3300006042 Bacteria 1462
32 Ga0075363_100079768 3300006048 Bacteria 1789
33 Ga0075362_10000620 3300006177 Bacteria 10385
34 Ga0075369_10010517 3300006186 Bacteria 3619
35 Ga0075366_10005017 3300006195 Bacteria 7149
36 Ga0075366_10006590 3300006195 Bacteria 6372
37 Ga0075366_10013354 3300006195 Bacteria 4673
38 Ga0075366_10025802 3300006195 Bacteria 3437
39 Ga0075366_10217523 3300006195 Bacteria 1164
40 Ga0075370_10002256 3300006353 Bacteria 8875
41 Ga0097620_100814538 3300006931 Bacteria 1021
42 Ga0105240_10020324 3300009093 Bacteria 8860
43 Ga0111539_11129592 3300009094 Bacteria 910
44 Ga0114129_10452310 3300009147 Bacteria 1684
45 Ga0105243_10001526 3300009148 Bacteria 20237
46 Ga0105243_10098436 3300009148 Bacteria 2423
47 Ga0105237_10002593 3300009545 Bacteria 22302
48 Ga0105249_10125521 3300009553 Bacteria 2443
49 Ga0105239_10072301 3300010375 Bacteria 3791
50 Ga0157375_10473165 3300013308 Bacteria 1418
51 Ga0157377_10000064 3300014745 Bacteria 81208
52 Ga0207645_10711913 3300025907 Bacteria 683
53 Ga0207684_10115427 3300025910 Bacteria 2300
54 Ga0207695_10555902 3300025913 Bacteria 1029
55 Ga0207671_10176945 3300025914 Bacteria 1659
56 Ga0207659_11375477 3300025926 Bacteria 605
57 Ga0207687_10099935 3300025927 Bacteria 2133
58 Ga0207687_10716277 3300025927 Bacteria 850
59 Ga0207644_10410598 3300025931 Unclassified 1108
60 Ga0207706_10770419 3300025933 Bacteria 819
61 Ga0207709_10001484 3300025935 Bacteria 16247
62 Ga0207709_10135324 3300025935 Bacteria 1686
63 Ga0207689_10058559 3300025942 Bacteria 3169
64 Ga0207689_10091517 3300025942 Bacteria 2499
65 Ga0207712_10184566 3300025961 Bacteria 1641
66 Ga0207658_10929668 3300025986 Bacteria 792
67 Ga0207677_10031716 3300026023 Bacteria 3387
68 Ga0207703_10635843 3300026035 Bacteria 1011
69 Ga0207639_10405081 3300026041 Bacteria 1230
70 Ga0207641_10190615 3300026088 Bacteria 1884
71 Ga0207648_10000127 3300026089 Bacteria 75361
72 Ga0207648_10351146 3300026089 Bacteria 1329
73 Ga0207676_10029205 3300026095 Bacteria 4126
74 Ga0207674_10050780 3300026116 Bacteria 4235
75 Ga0207698_10027199 3300026142 Bacteria 4057
76 Ga0209813_10051682 3300027866 Bacteria 1286
77 Ga0268266_10061486 3300028379 Bacteria 3239
78 Ga0307517_10162035 3300028786 Bacteria 1498
79 Ga0307515_10048568 3300028794 Bacteria 6413
80 Ga0307515_10159097 3300028794 Bacteria 2314
81 Ga0307513_10011094 3300031456 Bacteria 11233
82 Ga0307513_10046139 3300031456 Bacteria 4756
83 Ga0307509_10200899 3300031507 Bacteria 1831
84 Ga0307516_10000290 3300031730 Bacteria 65231
85 Ga0307516_10000326 3300031730 Bacteria 61941
86 Ga0307516_10125812 3300031730 Bacteria 2348
87 Ga0307405_10343971 3300031731 Bacteria 1148
88 Ga0307410_10207413 3300031852 Bacteria 1500
89 Ga0307406_10593815 3300031901 Bacteria 912
90 Ga0373939_0160377 3300035114 Bacteria 825
91 Ga0373960_0174290 3300035121 Bacteria 747
92 Ga0373937_0086989 3300036401 Bacteria 2892
93 Ga0373937_0108213 3300036401 Bacteria 2585
94 Ga0395899_0142044 3300037312 Bacteria 1707
95 Ga0395900_0017681 3300037418 Bacteria 7278
96 Ga0395900_0452441 3300037418 Bacteria 1240
97 Ga0395898_0002388 3300037466 Bacteria 22300
98 Ga0395898_0014794 3300037466 Bacteria 8009
99 Ga0395905_0000600 3300037471 Bacteria 48145
100 Ga0395905_0011097 3300037471 Bacteria 8717
101 Ga0395905_0011710 3300037471 Bacteria 8466
102 Ga0395905_0146673 3300037471 Bacteria 2220
103 Ga0395901_0019639 3300038443 Bacteria 6907
104 Ga0395901_0135399 3300038443 Bacteria 2589
105 Ga0436361_0871793 3300039447 Bacteria 10415
106 Ga0439433_0075042 3300041999 Bacteria 817
107 Ga0439433_0153751 3300041999 Bacteria 593
108 Ga0439449_0024111 3300042007 Bacteria 2275
109 Ga0439457_052784 3300042014 Bacteria 914
110 Ga0439462_0063685 3300042015 Bacteria 998
111 Ga0439462_0077743 3300042015 Bacteria 905
112 Ga0450898_000737 3300042134 Bacteria 3994
113 Ga0451577_0031119 3300042876 Bacteria 4816
114 Ga0451577_0045496 3300042876 Bacteria 3929
115 Ga0466969_0121546 3300044656 Bacteria 1215
116 Ga0466977_0000210 3300044666 Bacteria 15651
117 Ga0453683_0041285 3300044673 Bacteria 2897
118 Ga0453684_0023234 3300044712 Bacteria 9147
119 Ga0453684_0027873 3300044712 Bacteria 8080
120 Ga0466960_0113374 3300044901 Bacteria 1411
121 Ga0451576_0012184 3300045051 Bacteria 9689
122 Ga0451576_0562893 3300045051 Bacteria 1197
123 Ga0495620_0165644 3300046515 Bacteria 858
124 Ga0495628_0450000 3300046516 Bacteria 935
125 Ga0495624_0524099 3300046690 Unclassified 708
126 Ga0495636_0022816 3300047318 Bacteria 2532
127 Ga0501321_042875 3300049537 Bacteria 641
128 Ga0501039_0636942 3300049575 Bacteria 835
129 Ga0501075_0045926 3300049591 Bacteria 3280
130 Ga0501076_0392823 3300049592 Bacteria 1140
131 Ga0501077_0028668 3300049593 Bacteria 3539
132 Ga0501083_0925329 3300049744 Unclassified 567
133 Ga0501045_0290656 3300049824 Bacteria 1216
134 nmdc:mga03683_384027_c1 3300050489 Bacteria 669
135 nmdc:mga03683_90484_c2 3300050489 Bacteria 1013
136 nmdc:mga0yw44_335482_c1 3300050492 Bacteria 1016
137 nmdc:mga0k408_12754_c1 3300050493 Bacteria 4597
138 nmdc:mga0k408_366249_c1 3300050493 Bacteria 859
139 nmdc:mga0k408_44239_c1 3300050493 Bacteria 2567
140 nmdc:mga04h51_274795_c1 3300050495 Bacteria 681
141 nmdc:mga07m45_36684_c1 3300050496 Bacteria 2732
142 nmdc:mga07m45_57532_c1 3300050496 Bacteria 2199
143 nmdc:mga08y16_885159_c1 3300050511 Bacteria 880
144 nmdc:mga0sz30_23106_c1 3300050516 Bacteria 2527
145 Ga0495601_0213319 3300053077 Bacteria 1261
146 Ga0500559_0347670 3300053136 Bacteria 694
147 Ga0501082_0155473 3300060353 Bacteria 1987
148 2644246747 2643221644 Bacteria 6865017
149 2834643324 2834641062 Bacteria 5559922
150 Ga0500634_0048981
151 Ga0070676_10406866
152 Ga0068869_100046343
153 Ga0068869_100329756
154 Ga0070666_10137361
155 Ga0070666_10230702
156 Ga0070666_10697918
157 Ga0068868_101490189
158 Ga0070668_101291455
159 Ga0070675_100480863
160 Ga0070671_100034738
161 Ga0070671_100428911
162 Ga0070673_100547315
163 Ga0070659_100284455
164 Ga0070667_100849672
165 Ga0070663_100035058
166 Ga0070662_100184430
167 Ga0068867_100181149
168 Ga0070698_100856755
169 Ga0070699_100446111
170 Ga0068853_101262395
171 Ga0070665_100010086
172 Ga0070665_102010714
173 Ga0068855_100295777
174 Ga0068857_100276949
175 Ga0068852_100095711
176 Ga0068859_100814619
177 Ga0068858_100649182
178 Ga0068860_100091698
179 Ga0075365_10298732
180 Ga0075368_10065279
181 Ga0075363_100079768
182 Ga0075362_10000620
183 Ga0075369_10010517
184 Ga0075366_10005017
185 Ga0075366_10006590
186 Ga0075366_10013354
187 Ga0075366_10025802
188 Ga0075366_10217523
189 Ga0075370_10002256
190 Ga0097620_100814538
191 Ga0105240_10020324
192 Ga0111539_11129592
193 Ga0114129_10452310
194 Ga0105243_10001526
195 Ga0105243_10098436
196 Ga0105237_10002593
197 Ga0105249_10125521
198 Ga0105239_10072301
199 Ga0157375_10473165
200 Ga0157377_10000064
201 Ga0207645_10711913
202 Ga0207684_10115427
203 Ga0207695_10555902
204 Ga0207671_10176945
205 Ga0207659_11375477
206 Ga0207687_10099935
207 Ga0207687_10716277
208 Ga0207644_10410598
209 Ga0207706_10770419
210 Ga0207709_10001484
211 Ga0207709_10135324
212 Ga0207689_10058559
213 Ga0207689_10091517
214 Ga0207712_10184566
215 Ga0207658_10929668
216 Ga0207677_10031716
217 Ga0207703_10635843
218 Ga0207639_10405081
219 Ga0207641_10190615
220 Ga0207648_10000127
221 Ga0207648_10351146
222 Ga0207676_10029205
223 Ga0207674_10050780
224 Ga0207698_10027199
225 Ga0209813_10051682
226 Ga0268266_10061486
227 Ga0307517_10162035
228 Ga0307515_10048568
229 Ga0307515_10159097
230 Ga0307513_10011094
231 Ga0307513_10046139
232 Ga0307509_10200899
233 Ga0307516_10000290
234 Ga0307516_10000326
235 Ga0307516_10125812
236 Ga0307405_10343971
237 Ga0307410_10207413
238 Ga0307406_10593815
239 Ga0373939_0160377
240 Ga0373960_0174290
241 Ga0373937_0086989
242 Ga0373937_0108213
243 Ga0395899_0142044
244 Ga0395900_0017681
245 Ga0395900_0452441
246 Ga0395898_0002388
247 Ga0395898_0014794
248 Ga0395905_0000600
249 Ga0395905_0011097
250 Ga0395905_0011710
251 Ga0395905_0146673
252 Ga0395901_0019639
253 Ga0395901_0135399
254 Ga0436361_0871793
255 Ga0439433_0075042
256 Ga0439433_0153751
257 Ga0439449_0024111
258 Ga0439457_052784
259 Ga0439462_0063685
260 Ga0439462_0077743
261 Ga0450898_000737
262 Ga0451577_0031119
263 Ga0451577_0045496
264 Ga0466969_0121546
265 Ga0466977_0000210
266 Ga0453683_0041285
267 Ga0453684_0023234
268 Ga0453684_0027873
269 Ga0466960_0113374
270 Ga0451576_0012184
271 Ga0451576_0562893
272 Ga0495620_0165644
273 Ga0495628_0450000
274 Ga0495624_0524099
275 Ga0495636_0022816
276 Ga0501321_042875
277 Ga0501039_0636942
278 Ga0501075_0045926
279 Ga0501076_0392823
280 Ga0501077_0028668
281 Ga0501083_0925329
282 Ga0501045_0290656
283 nmdc:mga03683_384027_c1
284 nmdc:mga03683_90484_c2
285 nmdc:mga0yw44_335482_c1
286 nmdc:mga0k408_12754_c1
287 nmdc:mga0k408_366249_c1
288 nmdc:mga0k408_44239_c1
289 nmdc:mga04h51_274795_c1
290 nmdc:mga07m45_36684_c1
291 nmdc:mga07m45_57532_c1
292 nmdc:mga08y16_885159_c1
293 nmdc:mga0sz30_23106_c1
294 Ga0495601_0213319
295 Ga0500559_0347670
296 Ga0501082_0155473
297 2644246747
298 2834643324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16155

DUF4863

Domain of unknown function (DUF4863)

43

187

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5h-assembly2.cif.gz_D crystal structure of recombinant soybean proglycinin a3b4 subunit, its comparison with mature glycinin a3b4 subunit, responsible for hexamer assembly 0.7379 60 154
2d5f-assembly1.cif.gz_B crystal structure of recombinant soybean proglycinin a3b4 subunit, its comparison with mature glycinin a3b4 subunit, responsible for hexamer assembly 0.7356 60 154
4ask-assembly1.cif.gz_A crystal structure of jmjd3 with gsk-j1 0.7349 81 145
2xxz-assembly1.cif.gz_A crystal structure of the human jmjd3 jumonji domain 0.7282 82 147
2o1q-assembly1.cif.gz_A crystal structure of a putative acetylacetone dioxygenase (mpe_a3659) from methylibium petroleiphilum pm1 at 1.50 a resolution 0.7281 62 154
ID Description Score Start End Superfamily
af_Q54BR8_1_560_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.7593 74 148 2.60.120.650
2d5fB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7408 60 154 2.60.120.10
2vqaB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7293 60 148 2.60.120.10
af_A0A0R0GMV1_25_284_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7283 60 154 2.60.120.10
1l3jA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7086 60 149 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W5U198-F1-model_v4 deleted 0.9997 2 153
AF-A0A1R3WQI6-F1-model_v4 deleted 0.9995 2 154
AF-A0A6P2E0W3-F1-model_v4 Uncharacterized protein 0.9985 2 154
AF-A0A519MKG1-F1-model_v4 DUF4863 family protein 0.9979 29 154
AF-A9HZ76-F1-model_v4 DUF4863 domain-containing protein 0.9972 2 154

Map