F207115

General Info

Members Datasets Scaffolds Average Seq Length
149 117 294 316

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0039347|Ga0496126_0039347_2709_3866
Length 350
Sequence MTTNFSRWTVFVSALALSPTLWAHGNSTDAGDIDSQPSREVVAPTARSAYLAPQAVLAAATSSAPPGIRWEKSFAPIAEGKWTGHRLADGQPDIQGDWSNTIGNHDNFTDPQGGTPGDPVRRKRALGARDERAPSRVSDPADGQVPFKPWARAKQEEFAAGLWNATKPEYIEPLARCAPAGVPKSFMWHGYEIRQFPGYVLFLFNSGTRIIHLDGKAHLPDSIKLWNGDSRGHWEGNTLVVDVTNNNSKARFSRTGEFASENLRVEERYTFDTSGKRFNYVATLNDPTVYTRPFTVTIPMRRFVAGDPQDGWHYEVPLANHQGTQLVADHVERPCVENNGPFGQVVGSAQ

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
84 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
99 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
102 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
103 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
104 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
105 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
106 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
107 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
108 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
109 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
110 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
112 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
113 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
114 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
116 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
117 2894510363 Methylomonas sp. Kb3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.77
Nodule 0
Rhizoplane 1.34
Rhizosphere 76.51
Stem 0
Stem Tuber 0
Unclassified 8.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0039347 3300048929 Bacteria 4388
2 rootH1_10003926 3300003323 Bacteria 77590
3 Ga0055526_1000211 3300003771 Bacteria 50334
4 Ga0055530_10000278 3300003791 Bacteria 46428
5 Ga0055531_10000094 3300003794 Bacteria 96266
6 Ga0065712_10015910 3300005290 Bacteria 4239
7 Ga0065707_10081717 3300005295 Bacteria 68156
8 Ga0065707_10129019 3300005295 Bacteria 1951
9 Ga0070670_100003810 3300005331 Bacteria 12565
10 Ga0068869_100111874 3300005334 Unclassified 2078
11 Ga0070669_100028997 3300005353 Bacteria 3989
12 Ga0070675_100003487 3300005354 Bacteria 11930
13 Ga0070675_100006278 3300005354 Bacteria 9122
14 Ga0070675_100007707 3300005354 Bacteria 8333
15 Ga0070675_100028790 3300005354 Bacteria 4474
16 Ga0070675_100042754 3300005354 Unclassified 3703
17 Ga0070674_100000071 3300005356 Bacteria 46918
18 Ga0070700_100053425 3300005441 Bacteria 2521
19 Ga0070663_100007335 3300005455 Bacteria 6705
20 Ga0070678_100096868 3300005456 Bacteria 2277
21 Ga0070698_100275172 3300005471 Bacteria 1615
22 Ga0070672_100030274 3300005543 Bacteria 4065
23 Ga0070672_100097258 3300005543 Bacteria 2383
24 Ga0070665_100001096 3300005548 Bacteria 33479
25 Ga0068857_100118276 3300005577 Unclassified 2385
26 Ga0068859_100004581 3300005617 Bacteria 14100
27 Ga0068861_100000022 3300005719 Bacteria 72916
28 Ga0068861_100029694 3300005719 Bacteria 4001
29 Ga0068870_10008932 3300005840 Bacteria 4531
30 Ga0068862_100171059 3300005844 Bacteria 1945
31 Ga0068862_100311479 3300005844 Bacteria 1451
32 Ga0068865_100223218 3300006881 Bacteria 1474
33 Ga0097620_100004581 3300006931 Bacteria 14100
34 Ga0105244_10000402 3300009036 Bacteria 40241
35 Ga0105247_10066167 3300009101 Unclassified 2250
36 Ga0105249_10045531 3300009553 Unclassified 3991
37 Ga0157375_10329778 3300013308 Bacteria 1691
38 Ga0157375_10604824 3300013308 Bacteria 1255
39 Ga0163163_10439633 3300014325 Bacteria 1364
40 Ga0157380_10000275 3300014326 Bacteria 30843
41 Ga0157380_10016513 3300014326 Bacteria 5446
42 Ga0157380_10035414 3300014326 Unclassified 3856
43 Ga0157376_10264436 3300014969 Bacteria 1613
44 Ga0163161_10180940 3300017792 Bacteria 1616
45 Ga0163161_10313409 3300017792 Unclassified 1238
46 Ga0209564_1000027 3300025295 Bacteria 518458
47 Ga0209050_1000071 3300025298 Bacteria 295478
48 Ga0209257_1000027 3300025304 Bacteria 703541
49 Ga0207655_1009303 3300025728 Bacteria 6116
50 Ga0207643_10035876 3300025908 Bacteria 2782
51 Ga0207671_10173426 3300025914 Bacteria 1675
52 Ga0207650_10157867 3300025925 Unclassified 1795
53 Ga0207659_10000736 3300025926 Bacteria 19357
54 Ga0207659_10019050 3300025926 Bacteria 4508
55 Ga0207669_10003457 3300025937 Bacteria 6829
56 Ga0207669_10089584 3300025937 Bacteria 1998
57 Ga0207704_10294575 3300025938 Bacteria 1240
58 Ga0207691_10309355 3300025940 Bacteria 1356
59 Ga0207651_10308199 3300025960 Bacteria 1319
60 Ga0207712_10274066 3300025961 Unclassified 1374
61 Ga0207678_10012718 3300026067 Bacteria 7391
62 Ga0207708_10065868 3300026075 Unclassified 2769
63 Ga0207675_100000014 3300026118 Bacteria 133509
64 Ga0207675_100034711 3300026118 Bacteria 4704
65 Ga0207683_10116830 3300026121 Bacteria 2392
66 Ga0207683_10137567 3300026121 Unclassified 2199
67 Ga0268266_10000159 3300028379 Bacteria 126969
68 Ga0268265_10148610 3300028380 Bacteria 1973
69 Ga0265334_10000433 3300028573 Bacteria 21957
70 Ga0265318_10000874 3300028577 Bacteria 19733
71 Ga0265323_10003754 3300028653 Bacteria 6640
72 Ga0265330_10001882 3300031235 Bacteria 11671
73 Ga0265332_10002741 3300031238 Bacteria 8780
74 Ga0265328_10008138 3300031239 Bacteria 4340
75 Ga0265325_10002480 3300031241 Bacteria 12429
76 Ga0265331_10007249 3300031250 Bacteria 6432
77 Ga0265331_10038630 3300031250 Bacteria 2332
78 Ga0307509_10002182 3300031507 Bacteria 32144
79 Ga0307408_100024931 3300031548 Bacteria 4090
80 Ga0265313_10002408 3300031595 Bacteria 16191
81 Ga0265342_10004148 3300031712 Bacteria 11535
82 Ga0307414_10006831 3300032004 Bacteria 6383
83 Ga0395905_0084608 3300037471 Bacteria 2972
84 Ga0451807_0437073 3300041486 Bacteria 1758
85 Ga0451577_0000479 3300042876 Bacteria 68148
86 Ga0466969_0003690 3300044656 Bacteria 8151
87 Ga0466966_0045240 3300044684 Bacteria 2815
88 Ga0466961_0053144 3300044693 Bacteria 2585
89 Ga0466964_0002709 3300044706 Bacteria 6352
90 Ga0453684_0000534 3300044712 Bacteria 144649
91 Ga0453684_0438397 3300044712 Bacteria 1456
92 Ga0466971_0002829 3300044719 Bacteria 7355
93 Ga0466970_0011858 3300044765 Bacteria 4445
94 Ga0466959_0034481 3300045049 Bacteria 3743
95 Ga0451576_0137928 3300045051 Bacteria 2544
96 Ga0495638_0107500 3300046460 Bacteria 1661
97 Ga0495650_0000485 3300046471 Bacteria 60761
98 Ga0495650_0001397 3300046471 Bacteria 23673
99 Ga0495583_0000040 3300046506 Bacteria 236558
100 Ga0495606_0000120 3300046507 Bacteria 133907
101 Ga0495606_0000259 3300046507 Bacteria 93403
102 Ga0495606_0003968 3300046507 Bacteria 15178
103 Ga0495610_0002103 3300046512 Bacteria 16989
104 Ga0495621_0004946 3300046539 Bacteria 3792
105 Ga0495633_0002734 3300046558 Bacteria 12219
106 Ga0495633_0013704 3300046558 Bacteria 4263
107 Ga0495668_0000162 3300046616 Bacteria 101114
108 Ga0495668_0005395 3300046616 Bacteria 8694
109 Ga0495611_0057463 3300046648 Bacteria 1763
110 Ga0495625_0000093 3300046660 Bacteria 145874
111 Ga0495625_0001374 3300046660 Bacteria 29921
112 Ga0495625_0002074 3300046660 Bacteria 22456
113 Ga0495625_0008512 3300046660 Bacteria 8746
114 Ga0495625_0124336 3300046660 Bacteria 1752
115 Ga0495671_0020954 3300046692 Bacteria 3439
116 Ga0495674_0436347 3300047319 Unclassified 1054
117 Ga0495673_0021183 3300047469 Bacteria 3217
118 Ga0495686_0008720 3300047472 Bacteria 7397
119 Ga0496111_0204427 3300048914 Bacteria 1468
120 Ga0496122_0000092 3300048925 Bacteria 204463
121 Ga0496123_0000598 3300048926 Bacteria 61286
122 Ga0496125_0135008 3300048928 Bacteria 1728
123 Ga0495682_0011354 3300049460 Bacteria 3429
124 Ga0501046_0134788 3300049580 Bacteria 1871
125 Ga0501225_0000466 3300049705 Bacteria 12655
126 Ga0501245_001407 3300049708 Bacteria 3112
127 nmdc:mga0qj67_13709_c1 3300050509 Bacteria 6118
128 Ga0500643_001665 3300053087 Bacteria 12386
129 Ga0500583_0131769 3300053092 Bacteria 1240
130 Ga0500555_000808 3300053103 Bacteria 11260
131 Ga0500556_0000112 3300053104 Bacteria 70562
132 Ga0500556_0013468 3300053104 Bacteria 2476
133 Ga0500608_151792 3300053122 Bacteria 1014
134 Ga0500642_0000001 3300053130 Bacteria 1468402
135 Ga0500658_0006386 3300053134 Bacteria 4374
136 Ga0500658_0040802 3300053134 Unclassified 1860
137 Ga0500559_0012464 3300053136 Bacteria 3613
138 Ga0500586_000025 3300053145 Bacteria 27898
139 Ga0500588_0001141 3300053146 Bacteria 4875
140 Ga0500616_0000105 3300053153 Bacteria 157881
141 Ga0500622_0084760 3300053156 Bacteria 1582
142 Ga0500636_0088964 3300053177 Bacteria 1771
143 Ga0500645_000064 3300053730 Bacteria 84824
144 Ga0466962_0002537 3300061719 Bacteria 8673
145 2643949594 2643221588 Bacteria 3692460
146 2643950488 2643221588 Bacteria 3692460
147 2894513708 2894510363 Bacteria 5121143
148 Ga0496126_0039347
149 rootH1_10003926
150 Ga0055526_1000211
151 Ga0055530_10000278
152 Ga0055531_10000094
153 Ga0065712_10015910
154 Ga0065707_10081717
155 Ga0065707_10129019
156 Ga0070670_100003810
157 Ga0068869_100111874
158 Ga0070669_100028997
159 Ga0070675_100003487
160 Ga0070675_100006278
161 Ga0070675_100007707
162 Ga0070675_100028790
163 Ga0070675_100042754
164 Ga0070674_100000071
165 Ga0070700_100053425
166 Ga0070663_100007335
167 Ga0070678_100096868
168 Ga0070698_100275172
169 Ga0070672_100030274
170 Ga0070672_100097258
171 Ga0070665_100001096
172 Ga0068857_100118276
173 Ga0068859_100004581
174 Ga0068861_100000022
175 Ga0068861_100029694
176 Ga0068870_10008932
177 Ga0068862_100171059
178 Ga0068862_100311479
179 Ga0068865_100223218
180 Ga0097620_100004581
181 Ga0105244_10000402
182 Ga0105247_10066167
183 Ga0105249_10045531
184 Ga0157375_10329778
185 Ga0157375_10604824
186 Ga0163163_10439633
187 Ga0157380_10000275
188 Ga0157380_10016513
189 Ga0157380_10035414
190 Ga0157376_10264436
191 Ga0163161_10180940
192 Ga0163161_10313409
193 Ga0209564_1000027
194 Ga0209050_1000071
195 Ga0209257_1000027
196 Ga0207655_1009303
197 Ga0207643_10035876
198 Ga0207671_10173426
199 Ga0207650_10157867
200 Ga0207659_10000736
201 Ga0207659_10019050
202 Ga0207669_10003457
203 Ga0207669_10089584
204 Ga0207704_10294575
205 Ga0207691_10309355
206 Ga0207651_10308199
207 Ga0207712_10274066
208 Ga0207678_10012718
209 Ga0207708_10065868
210 Ga0207675_100000014
211 Ga0207675_100034711
212 Ga0207683_10116830
213 Ga0207683_10137567
214 Ga0268266_10000159
215 Ga0268265_10148610
216 Ga0265334_10000433
217 Ga0265318_10000874
218 Ga0265323_10003754
219 Ga0265330_10001882
220 Ga0265332_10002741
221 Ga0265328_10008138
222 Ga0265325_10002480
223 Ga0265331_10007249
224 Ga0265331_10038630
225 Ga0307509_10002182
226 Ga0307408_100024931
227 Ga0265313_10002408
228 Ga0265342_10004148
229 Ga0307414_10006831
230 Ga0395905_0084608
231 Ga0451807_0437073
232 Ga0451577_0000479
233 Ga0466969_0003690
234 Ga0466966_0045240
235 Ga0466961_0053144
236 Ga0466964_0002709
237 Ga0453684_0000534
238 Ga0453684_0438397
239 Ga0466971_0002829
240 Ga0466970_0011858
241 Ga0466959_0034481
242 Ga0451576_0137928
243 Ga0495638_0107500
244 Ga0495650_0000485
245 Ga0495650_0001397
246 Ga0495583_0000040
247 Ga0495606_0000120
248 Ga0495606_0000259
249 Ga0495606_0003968
250 Ga0495610_0002103
251 Ga0495621_0004946
252 Ga0495633_0002734
253 Ga0495633_0013704
254 Ga0495668_0000162
255 Ga0495668_0005395
256 Ga0495611_0057463
257 Ga0495625_0000093
258 Ga0495625_0001374
259 Ga0495625_0002074
260 Ga0495625_0008512
261 Ga0495625_0124336
262 Ga0495671_0020954
263 Ga0495674_0436347
264 Ga0495673_0021183
265 Ga0495686_0008720
266 Ga0496111_0204427
267 Ga0496122_0000092
268 Ga0496123_0000598
269 Ga0496125_0135008
270 Ga0495682_0011354
271 Ga0501046_0134788
272 Ga0501225_0000466
273 Ga0501245_001407
274 nmdc:mga0qj67_13709_c1
275 Ga0500643_001665
276 Ga0500583_0131769
277 Ga0500555_000808
278 Ga0500556_0000112
279 Ga0500556_0013468
280 Ga0500608_151792
281 Ga0500642_0000001
282 Ga0500658_0006386
283 Ga0500658_0040802
284 Ga0500559_0012464
285 Ga0500586_000025
286 Ga0500588_0001141
287 Ga0500616_0000105
288 Ga0500622_0084760
289 Ga0500636_0088964
290 Ga0500645_000064
291 Ga0466962_0002537
292 2643949594
293 2643950488
294 2894513708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3emo-assembly1.cif.gz_B crystal structure of transmembrane hia 973-1098 0.7075 198 268
6hb8-assembly1.cif.gz_D crystal structure of oxa-517 beta-lactamase 0.6978 228 271
5odz-assembly1.cif.gz_B crystal structure of the beta-lactamase oxa-163 0.6858 228 271
2j82-assembly1.cif.gz_A-2 structural analysis of the pp2c family phosphatase tppha from thermosynechococcus elongatus 0.6812 228 248
4wmc-assembly4.cif.gz_G oxa-48 covalent complex with avibactam inhibitor 0.6795 228 271
ID Description Score Start End Superfamily
af_Q0IU89_388_485_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.744 228 270 2.60.40.1230
af_A0A0R4IFW4_170_326_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.7299 199 266 3.40.1000.30
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7286 228 268 3.10.129.10
5d2uA00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.7157 228 248 3.60.40.10
5hw3A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6968 228 267 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A2V8LNG2-F1-model_v4 Uncharacterized protein 0.925 108 273
AF-A0A3C1VUZ9-F1-model_v4 Acetoacetate decarboxylase 0.9165 109 270
AF-A0A2V8GMW0-F1-model_v4 Uncharacterized protein 0.9155 136 273
AF-A0A2V8GSQ7-F1-model_v4 Uncharacterized protein 0.9132 136 273
AF-A0A7X5WE72-F1-model_v4 deleted 0.913 176 270

Map