F204486

General Info

Members Datasets Scaffolds Average Seq Length
148 121 141 495

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_000003|Ga0500555_000003_250592_252307
Length 548
Sequence LARLENGAGLSRMLFNSYIFIFGFLPLTFVGFWWLTRYQHSRGAVIWLAVTSLTYYAWWSLCDGRGDGVIGLRKTYFFLPLLLASIFVNYGFGYNLIRDRQIGRTRRCQVLLTLGLVFNLGLLAYFKYANFFIENFNALTGAHQESFGRIILPLGISFYTFQKIAYLVDAYRGEVTKTNFLDYLLFVTFFPQLIAGPIVHHKEIMPQFDRAKLRPPTLENCSLGLTLFVMGLFNKCLLADGIAPLANKAFDELASGVNLKLFEAWAGALAYSCQLYFDFSGYSYMAIGLGLFFNIRMPANFFSPYQAVNIIDFWRRWHMTLSRFLRDYLYISLGGNRRGPIRRYVNLGLTMVIGGFWHGAGWTWIVWGALHGLYLCVNHAWHAFRRFLGHDLTKTSRLGTVASRTLTFIAVVVGWVFFRAKDLDSAWRMMKGLFGFYGANLPIFLLPDLGFLAPYVKFRGWLPQLNPEPEATVFLAFLLIVIFACPNVLQMTHRFRPALGLNYDKAEVHCRPRWQFQYSVRWALWLGLAAALAVGTLSQVSEFLYFQF

Samples

Sample ID Description Type Environment
1 2738541358 Bacillus sp. OV752 Isolate Unclassified
2 2738543006 Bacillus sp. OK077 Isolate Unclassified
3 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
47 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
109 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
110 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
117 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
118 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
119 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
120 8022792930 Bacillus sp. Xin Isolate Rhizosphere
121 8023438354 Bacillus sp. BH2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 0
Isolates 4.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.78
Nodule 1.35
Rhizoplane 0.68
Rhizosphere 76.35
Stem 0
Stem Tuber 0
Unclassified 12.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000741 3300001991 Bacteria 4069
2 JGI25159J45721_1000858 3300002987 Bacteria 13232
3 JGI25165J46597_1000013 3300003214 Bacteria 402100
4 rootL2_10045900 3300003322 Bacteria 7725
5 rootH1_10081411 3300003323 Bacteria 8533
6 Ga0070670_100000010 3300005331 Bacteria 277365
7 Ga0070671_100000060 3300005355 Bacteria 73698
8 Ga0070674_100024285 3300005356 Bacteria 3933
9 Ga0070667_100000124 3300005367 Bacteria 98412
10 Ga0070685_10000001 3300005466 Bacteria 349867
11 Ga0070698_100038182 3300005471 Bacteria 4948
12 Ga0070698_100053556 3300005471 Bacteria 4100
13 Ga0070699_100041633 3300005518 Bacteria 3976
14 Ga0070699_100093894 3300005518 Bacteria 2626
15 Ga0070699_100172412 3300005518 Bacteria 1917
16 Ga0070679_100049190 3300005530 Bacteria 4199
17 Ga0070697_100022125 3300005536 Bacteria 5044
18 Ga0070697_100061463 3300005536 Bacteria 3064
19 Ga0070697_100093147 3300005536 Bacteria 2494
20 Ga0070665_100000431 3300005548 Bacteria 61155
21 Ga0070665_100027601 3300005548 Bacteria 5718
22 Ga0068855_100012689 3300005563 Bacteria 10166
23 Ga0068856_100000604 3300005614 Bacteria 39311
24 Ga0068856_100116809 3300005614 Bacteria 2669
25 Ga0068859_100018617 3300005617 Bacteria 6981
26 Ga0068859_100037490 3300005617 Bacteria 4865
27 Ga0068864_100000018 3300005618 Bacteria 277365
28 Ga0068863_100000348 3300005841 Bacteria 47147
29 Ga0068860_100001248 3300005843 Bacteria 27755
30 Ga0068860_100012541 3300005843 Bacteria 8344
31 Ga0068862_100000032 3300005844 Bacteria 179887
32 Ga0068862_100001417 3300005844 Bacteria 22203
33 Ga0081455_10024997 3300005937 Bacteria 5520
34 Ga0081539_10000075 3300005985 Bacteria 229419
35 Ga0070717_10000015 3300006028 Bacteria 208620
36 Ga0075363_100082402 3300006048 Bacteria 1761
37 Ga0070716_100024830 3300006173 Bacteria 3192
38 Ga0070712_100136277 3300006175 Bacteria 1867
39 Ga0075367_10003912 3300006178 Bacteria 7182
40 Ga0068871_100012615 3300006358 Bacteria 6240
41 Ga0068871_100059890 3300006358 Bacteria 3104
42 Ga0075428_100016378 3300006844 Bacteria 8192
43 Ga0075431_100000026 3300006847 Bacteria 75269
44 Ga0075431_100262308 3300006847 Bacteria 1753
45 Ga0075434_100055115 3300006871 Bacteria 3951
46 Ga0075429_100010497 3300006880 Bacteria 8010
47 Ga0075436_100039291 3300006914 Bacteria 3266
48 Ga0097620_100018617 3300006931 Bacteria 6981
49 Ga0097620_100037487 3300006931 Bacteria 4865
50 Ga0099795_10003476 3300007788 Bacteria 3904
51 Ga0105250_10009316 3300009092 Bacteria 4141
52 Ga0105240_10024496 3300009093 Bacteria 7952
53 Ga0105240_10117087 3300009093 Bacteria 3213
54 Ga0105247_10015570 3300009101 Bacteria 4553
55 Ga0105241_10028215 3300009174 Bacteria 4182
56 Ga0105249_10000017 3300009553 Bacteria 277115
57 Ga0123341_1000001 3300009765 Bacteria 314908
58 Ga0123342_1036682 3300009766 Bacteria 2010
59 Ga0099796_10001540 3300010159 Bacteria 4696
60 Ga0157370_10007573 3300013104 Bacteria 11796
61 Ga0157370_10013694 3300013104 Bacteria 8336
62 Ga0157378_10003637 3300013297 Bacteria 13647
63 Ga0157375_10011571 3300013308 Bacteria 7793
64 Ga0163163_10000095 3300014325 Bacteria 93905
65 Ga0163163_10000203 3300014325 Bacteria 61545
66 Ga0157379_10002573 3300014968 Bacteria 15232
67 Ga0213873_10008307 3300021358 Bacteria 2115
68 Ga0213876_10000957 3300021384 Bacteria 18983
69 Ga0213875_10005011 3300021388 Bacteria 7182
70 Ga0209233_1000013 3300025261 Bacteria 1013785
71 Ga0209130_1000445 3300025284 Bacteria 43640
72 Ga0209130_1007688 3300025284 Bacteria 3289
73 Ga0209025_1002683 3300025294 Bacteria 18160
74 Ga0209025_1002906 3300025294 Bacteria 17109
75 Ga0209025_1003780 3300025294 Bacteria 13858
76 Ga0207710_10005891 3300025900 Bacteria 5259
77 Ga0207707_10082436 3300025912 Bacteria 2808
78 Ga0207695_10047091 3300025913 Bacteria 4566
79 Ga0207693_10169267 3300025915 Bacteria 1721
80 Ga0207646_10084752 3300025922 Bacteria 2835
81 Ga0207694_10020353 3300025924 Bacteria 5018
82 Ga0207650_10000003 3300025925 Bacteria 1123235
83 Ga0207700_10004429 3300025928 Bacteria 8281
84 Ga0207664_10057661 3300025929 Bacteria 3087
85 Ga0207644_10000036 3300025931 Bacteria 128383
86 Ga0207669_10014625 3300025937 Bacteria 3938
87 Ga0207711_10002662 3300025941 Bacteria 15789
88 Ga0207667_10024485 3300025949 Bacteria 6627
89 Ga0207667_10128764 3300025949 Bacteria 2607
90 Ga0207712_10000012 3300025961 Bacteria 392363
91 Ga0207658_10000007 3300025986 Bacteria 329651
92 Ga0207703_10044108 3300026035 Bacteria 3582
93 Ga0207702_10000352 3300026078 Bacteria 52757
94 Ga0207702_10016571 3300026078 Bacteria 6098
95 Ga0207641_10000823 3300026088 Bacteria 32987
96 Ga0207676_10000003 3300026095 Bacteria 1123235
97 Ga0268266_10006566 3300028379 Bacteria 10634
98 Ga0268265_10000081 3300028380 Bacteria 120869
99 Ga0268265_10000387 3300028380 Bacteria 46961
100 Ga0268264_10000009 3300028381 Bacteria 724972
101 Ga0268264_10001401 3300028381 Bacteria 22535
102 Ga0307517_10033812 3300028786 Bacteria 5851
103 Ga0265338_10003763 3300028800 Bacteria 21077
104 Ga0265331_10065557 3300031250 Unclassified 1707
105 Ga0265327_10000002 3300031251 Bacteria 856593
106 Ga0307513_10000276 3300031456 Bacteria 74546
107 Ga0307408_100005384 3300031548 Bacteria 8575
108 Ga0307408_100086673 3300031548 Bacteria 2354
109 Ga0307516_10031369 3300031730 Bacteria 5357
110 Ga0307406_10005924 3300031901 Bacteria 6706
111 Ga0373955_0141593 3300035172 Bacteria 1411
112 Ga0373937_0167176 3300036401 Bacteria 2063
113 Ga0395898_0120408 3300037466 Bacteria 2514
114 Ga0436364_1417082 3300037853 Bacteria 5438
115 Ga0436364_1557054 3300037853 Bacteria 23701
116 Ga0436365_0156475 3300039437 Bacteria 37868
117 Ga0436365_1790331 3300039437 Bacteria 6912
118 Ga0436360_0021174 3300039438 Bacteria 2128
119 Ga0436363_1656558 3300039450 Bacteria 5415
120 Ga0436362_1196398 3300039453 Bacteria 19815
121 Ga0451576_0000003 3300045051 Bacteria 1550573
122 Ga0451576_0018985 3300045051 Bacteria 7512
123 Ga0495641_0006721 3300046461 Bacteria 7392
124 Ga0495618_0007325 3300046514 Bacteria 6676
125 Ga0495667_0020333 3300046559 Bacteria 4480
126 Ga0495635_0009230 3300046663 Bacteria 6889
127 Ga0495600_0018855 3300046809 Bacteria 4402
128 Ga0496112_0027857 3300048915 Bacteria 5450
129 Ga0496124_0083611 3300048927 Bacteria 2618
130 Ga0501033_0000024 3300049570 Bacteria 175859
131 Ga0501038_0018543 3300049574 Bacteria 6284
132 Ga0501222_008184 3300049662 Bacteria 1389
133 Ga0501257_000428 3300049686 Bacteria 8303
134 Ga0501225_0003993 3300049705 Bacteria 4416
135 nmdc:mga0yw44_3024_c1 3300050492 Bacteria 7348
136 nmdc:mga09592_1540_c1 3300050508 Bacteria 18541
137 nmdc:mga06r32_354_c1 3300050510 Bacteria 38365
138 nmdc:mga08x19_20134_c1 3300050514 Bacteria 4106
139 Ga0495619_0034209 3300053085 Bacteria 3303
140 Ga0500555_000003 3300053103 Bacteria 392994
141 Ga0500595_002371 3300053119 Bacteria 9414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049662 Ga0501222_008184 Ga0501222_008184_150_1334 380
2 3300035172 Ga0373955_0141593 Ga0373955_0141593_101_1381 387
3 3300013104 Ga0157370_10013694 Ga0157370_100136945 416
4 3300028800 Ga0265338_10003763 Ga0265338_1000376315 426
5 3300021388 Ga0213875_10005011 Ga0213875_100050113 429
6 3300037853 Ga0436364_1557054 Ga0436364_1557054_19558_20928 429
7 3300005614 Ga0068856_100116809 Ga0068856_1001168091 430
8 3300005530 Ga0070679_100049190 Ga0070679_1000491902 436
9 3300005548 Ga0070665_100000431 Ga0070665_10000043158 436
10 3300005548 Ga0070665_100027601 Ga0070665_1000276015 436
11 3300009174 Ga0105241_10028215 Ga0105241_100282154 436
12 3300025913 Ga0207695_10047091 Ga0207695_100470914 436
13 3300028379 Ga0268266_10006566 Ga0268266_100065668 436
14 3300049686 Ga0501257_000428 Ga0501257_000428_4457_5809 436
15 3300049705 Ga0501225_0003993 Ga0501225_0003993_766_2118 436
16 3300005985 Ga0081539_10000075 Ga0081539_10000075125 438
17 3300006175 Ga0070712_100136277 Ga0070712_1001362772 441
18 3300014325 Ga0163163_10000095 Ga0163163_1000009564 441
19 3300039438 Ga0436360_0021174 Ga0436360_0021174_275_1783 441
20 iso_pu_bacteria 641228493 641334750 441
21 iso_pu_bacteria 643348555 643390755 441
22 iso_pu_bacteria 8022792930 8022797908 441
23 iso_pu_bacteria 2738541358 2739159083 442
24 iso_pu_bacteria 2738543006 2739211742 442
25 iso_pu_bacteria 8023438354 8023443567 442
26 3300025912 Ga0207707_10082436 Ga0207707_100824362 444
27 3300037466 Ga0395898_0120408 Ga0395898_0120408_460_1953 444
28 3300031250 Ga0265331_10065557 Ga0265331_100655571 445
29 3300031251 Ga0265327_10000002 Ga0265327_10000002592 445
30 3300002987 JGI25159J45721_1000858 JGI25159J45721_10008587 446
31 3300003323 rootH1_10081411 rootH1_100814112 446
32 3300005518 Ga0070699_100041633 Ga0070699_1000416332 446
33 3300005563 Ga0068855_100012689 Ga0068855_1000126896 446
34 3300009092 Ga0105250_10009316 Ga0105250_100093162 446
35 3300013104 Ga0157370_10007573 Ga0157370_100075737 446
36 3300025284 Ga0209130_1000445 Ga0209130_100044528 446
37 3300025284 Ga0209130_1007688 Ga0209130_10076883 446
38 3300025294 Ga0209025_1002683 Ga0209025_10026836 446
39 3300025294 Ga0209025_1002906 Ga0209025_10029062 446
40 3300025294 Ga0209025_1003780 Ga0209025_10037803 446
41 3300025949 Ga0207667_10024485 Ga0207667_100244855 446
42 3300045051 Ga0451576_0018985 Ga0451576_0018985_1099_2628 446
43 3300036401 Ga0373937_0167176 Ga0373937_0167176_379_1875 447
44 3300009093 Ga0105240_10024496 Ga0105240_100244963 448
45 3300031730 Ga0307516_10031369 Ga0307516_100313692 448
46 3300014968 Ga0157379_10002573 Ga0157379_100025738 450
47 3300053119 Ga0500595_002371 Ga0500595_002371_2101_3591 451
48 3300006847 Ga0075431_100262308 Ga0075431_1002623082 452
49 3300009765 Ga0123341_1000001 Ga0123341_1000001200 452
50 3300009766 Ga0123342_1036682 Ga0123342_10366822 452
51 3300045051 Ga0451576_0000003 Ga0451576_0000003_479050_480516 452
52 3300005536 Ga0070697_100061463 Ga0070697_1000614632 454
53 3300003214 JGI25165J46597_1000013 JGI25165J46597_100001369 456
54 3300005471 Ga0070698_100053556 Ga0070698_1000535561 456
55 3300005518 Ga0070699_100172412 Ga0070699_1001724121 456
56 3300005536 Ga0070697_100093147 Ga0070697_1000931472 456
57 3300006358 Ga0068871_100012615 Ga0068871_1000126153 456
58 3300006358 Ga0068871_100059890 Ga0068871_1000598903 456
59 3300009093 Ga0105240_10117087 Ga0105240_101170873 456
60 3300025261 Ga0209233_1000013 Ga0209233_1000013323 456
61 3300025922 Ga0207646_10084752 Ga0207646_100847521 456
62 3300005614 Ga0068856_100000604 Ga0068856_10000060430 457
63 3300026078 Ga0207702_10000352 Ga0207702_1000035223 457
64 3300003322 rootL2_10045900 rootL2_100459003 458
65 3300006914 Ga0075436_100039291 Ga0075436_1000392912 459
66 3300007788 Ga0099795_10003476 Ga0099795_100034761 459
67 3300025915 Ga0207693_10169267 Ga0207693_101692671 459
68 3300025928 Ga0207700_10004429 Ga0207700_100044293 459
69 3300025929 Ga0207664_10057661 Ga0207664_100576613 459
70 3300026078 Ga0207702_10016571 Ga0207702_100165712 459
71 3300048915 Ga0496112_0027857 Ga0496112_0027857_3297_4865 459
72 3300050514 nmdc:mga08x19_20134_c1 nmdc:mga08x19_20134_c1_1962_3530 459
73 3300046461 Ga0495641_0006721 Ga0495641_0006721_4430_5986 461
74 3300005355 Ga0070671_100000060 Ga0070671_10000006058 463
75 3300005617 Ga0068859_100018617 Ga0068859_1000186172 463
76 3300005841 Ga0068863_100000348 Ga0068863_10000034836 463
77 3300005843 Ga0068860_100001248 Ga0068860_1000012484 463
78 3300005844 Ga0068862_100000032 Ga0068862_10000003221 463
79 3300006931 Ga0097620_100018617 Ga0097620_1000186176 463
80 3300009553 Ga0105249_10000017 Ga0105249_10000017250 463
81 3300025931 Ga0207644_10000036 Ga0207644_1000003650 463
82 3300025961 Ga0207712_10000012 Ga0207712_10000012100 463
83 3300026088 Ga0207641_10000823 Ga0207641_100008235 463
84 3300028380 Ga0268265_10000081 Ga0268265_1000008188 463
85 3300028381 Ga0268264_10001401 Ga0268264_100014019 463
86 3300031456 Ga0307513_10000276 Ga0307513_1000027653 463
87 3300010159 Ga0099796_10001540 Ga0099796_100015403 464
88 iso_pu_bacteria 2786546940 2788436461 464
89 3300005331 Ga0070670_100000010 Ga0070670_10000001040 465
90 3300005367 Ga0070667_100000124 Ga0070667_10000012476 465
91 3300005466 Ga0070685_10000001 Ga0070685_10000001128 465
92 3300005617 Ga0068859_100037490 Ga0068859_1000374903 465
93 3300005618 Ga0068864_100000018 Ga0068864_100000018255 465
94 3300005843 Ga0068860_100012541 Ga0068860_1000125413 465
95 3300005844 Ga0068862_100001417 Ga0068862_1000014178 465
96 3300006931 Ga0097620_100037487 Ga0097620_1000374873 465
97 3300009101 Ga0105247_10015570 Ga0105247_100155702 465
98 3300014325 Ga0163163_10000203 Ga0163163_1000020326 465
99 3300025900 Ga0207710_10005891 Ga0207710_100058912 465
100 3300025925 Ga0207650_10000003 Ga0207650_10000003461 465
101 3300025941 Ga0207711_10002662 Ga0207711_100026623 465
102 3300025986 Ga0207658_10000007 Ga0207658_10000007250 465
103 3300026035 Ga0207703_10044108 Ga0207703_100441082 465
104 3300026095 Ga0207676_10000003 Ga0207676_10000003634 465
105 3300028380 Ga0268265_10000387 Ga0268265_1000038721 465
106 3300028381 Ga0268264_10000009 Ga0268264_10000009203 465
107 3300006871 Ga0075434_100055115 Ga0075434_1000551154 466
108 3300031548 Ga0307408_100005384 Ga0307408_1000053846 467
109 3300031901 Ga0307406_10005924 Ga0307406_100059243 467
110 3300048927 Ga0496124_0083611 Ga0496124_0083611_18_1487 467
111 3300006048 Ga0075363_100082402 Ga0075363_1000824021 468
112 3300006178 Ga0075367_10003912 Ga0075367_100039125 468
113 3300021358 Ga0213873_10008307 Ga0213873_100083072 468
114 3300021384 Ga0213876_10000957 Ga0213876_1000095716 468
115 3300025924 Ga0207694_10020353 Ga0207694_100203532 468
116 3300031548 Ga0307408_100086673 Ga0307408_1000866731 468
117 3300037853 Ga0436364_1417082 Ga0436364_1417082_3326_4795 468
118 3300039437 Ga0436365_0156475 Ga0436365_0156475_23579_25048 468
119 3300039437 Ga0436365_1790331 Ga0436365_1790331_952_2421 468
120 3300039450 Ga0436363_1656558 Ga0436363_1656558_1347_2816 468
121 3300039453 Ga0436362_1196398 Ga0436362_1196398_7060_8529 468
122 3300050492 nmdc:mga0yw44_3024_c1 nmdc:mga0yw44_3024_c1_532_2058 468
123 3300046514 Ga0495618_0007325 Ga0495618_0007325_4982_6550 469
124 3300046559 Ga0495667_0020333 Ga0495667_0020333_1361_2929 469
125 3300046663 Ga0495635_0009230 Ga0495635_0009230_4932_6500 469
126 3300046809 Ga0495600_0018855 Ga0495600_0018855_2675_4243 469
127 3300053085 Ga0495619_0034209 Ga0495619_0034209_182_1750 469
128 3300049570 Ga0501033_0000024 Ga0501033_0000024_111249_112730 470
129 3300049574 Ga0501038_0018543 Ga0501038_0018543_3151_4632 470
130 3300005937 Ga0081455_10024997 Ga0081455_100249976 471
131 3300025949 Ga0207667_10128764 Ga0207667_101287642 471
132 3300005471 Ga0070698_100038182 Ga0070698_1000381823 472
133 3300005518 Ga0070699_100093894 Ga0070699_1000938942 472
134 3300005536 Ga0070697_100022125 Ga0070697_1000221254 472
135 3300006173 Ga0070716_100024830 Ga0070716_1000248303 472
136 3300028786 Ga0307517_10033812 Ga0307517_100338125 473
137 3300006028 Ga0070717_10000015 Ga0070717_10000015143 474
138 3300006844 Ga0075428_100016378 Ga0075428_1000163782 477
139 3300006847 Ga0075431_100000026 Ga0075431_10000002613 477
140 3300006880 Ga0075429_100010497 Ga0075429_1000104976 477
141 3300050508 nmdc:mga09592_1540_c1 nmdc:mga09592_1540_c1_1288_2847 477
142 3300050510 nmdc:mga06r32_354_c1 nmdc:mga06r32_354_c1_10286_11845 477
143 3300053103 Ga0500555_000003 Ga0500555_000003_250592_252307 481
144 3300005356 Ga0070674_100024285 Ga0070674_1000242852 484
145 3300013297 Ga0157378_10003637 Ga0157378_100036376 484
146 3300013308 Ga0157375_10011571 Ga0157375_100115714 484
147 3300025937 Ga0207669_10014625 Ga0207669_100146252 484
148 3300001991 JGI24743J22301_10000741 JGI24743J22301_100007413 485

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03062

MBOAT

MBOAT, membrane-bound O-acyltransferase family

24

415

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6buh-assembly3.cif.gz_F crystal structure of a membrane protein, crystal form ii 0.6941 8 396
7ewt-assembly1.cif.gz_A the crystal structure of lysophospholipid acyltransferase lpcat3 (mobat5) in its monomeric and apo form 0.6657 16 420
6buh-assembly3.cif.gz_F crystal structure of a membrane protein, crystal form ii 0.6544 8 396
7q1u-assembly1.cif.gz_A structure of hedgehog acyltransferase (hhat) in complex with megabody 177 bound to non-hydrolysable palmitoyl-coa (composite map) 0.6486 12 418
7q6z-assembly1.cif.gz_A structure of hedgehog acyltransferase (hhat) in complex with megabody 177 bound to imp-1575 0.6448 13 420
ID Description Score Start End Superfamily
af_A0A1D6LT12_239_483_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5508 181 393 1.20.120.550
af_Q960U8_189_547_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5382 50 377 1.20.120.550
af_Q55BH9_205_591_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5167 5 380 1.20.120.550
af_Q54SV5_129_469_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.513 43 376 1.20.120.550
af_Q54SV5_129_469_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.504 43 376 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A7C5NCW9-F1-model_v4 MBOAT family protein 0.9699 1 211 GO:0016020
GO:0016746
AF-A0A524Q7E8-F1-model_v4 MBOAT family protein 0.9576 1 300 GO:0005886
GO:0016746
GO:0042121
AF-A0A534CKL0-F1-model_v4 Probable alginate O-acetylase AlgI (Alginate biosynthesis protein AlgI) 0.9568 1 349 GO:0005886
GO:0016746
GO:0042121
AF-A0A7C5NCW9-F1-model_v4 MBOAT family protein 0.9566 1 211 GO:0016020
GO:0016746
AF-A0A2T2WA00-F1-model_v4 Membrane-bound O-acyltransferase family protein 0.9552 1 485 GO:0005886
GO:0016746
GO:0042121

Feature Viewer

pLDDT pTM Quality
85.51 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map