F204249

General Info

Members Datasets Scaffolds Average Seq Length
148 108 296 471

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0205818|Ga0496109_0205818_69_1610
Length 513
Sequence VRLAALLDDGTAVALHASDTSGVLAMRGRIDGSKVIAFCTDGTRMGGAMGHEGCRHIVDAIDMAVRERVPVIGLWHSGGARLAEGVEALDGVGSVFAAIVRASGRVPQISVVLGAAAGGAAYGPALTDVVIMSPDGRVFVTGPDVVKSVTGEQVDMEALGGPSAHGRKSGVVHIVADSEADALLRARKVASLFSRPGIAGFEGMTDDPELAKKLPEHRARAYNVKPVIDGILDEPMEELQAKWAPNIVIGLGRLGGRSVGVVANNPLRLGGCLDSTSAEKASRFVRMCDAFGIPLLVVVDVPGYLPGVGQEWDGVVRRGAKLLHAFAEAVVPRVTLVTRKAYGGAYIAMNSKALGATAVFAWPDAEIAVMGSKAAVGILHRRKLAAAPDDERDALHAALAQEHERVAGGVARAIELGVVDEVITPAQTRRRVAEALASAPAGRGGHSNIPLRFSTPTQLDLFDRRPGLETPPCLSAAEPLGRRGRRSRSRRRPPIAGHARPGXXXXQPPRRDR

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
3 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
4 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
5 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
7 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
8 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
9 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
10 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
11 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
12 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
17 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
28 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
29 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
30 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
31 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
32 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
33 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
34 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
35 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
36 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
37 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
38 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
39 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
40 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
41 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
42 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
43 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
44 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
45 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
46 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
47 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
48 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
49 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
50 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
51 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
52 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
53 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
54 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
55 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
56 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
57 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
58 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
59 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
60 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
61 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
62 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
63 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
64 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
65 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
66 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
67 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
68 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
69 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
70 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
81 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
82 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
84 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
85 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
86 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
89 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
90 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
91 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
92 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
93 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
94 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
95 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
96 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
97 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
98 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
99 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
100 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
101 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
102 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
103 2922554459 Rhodococcus sp. 66b Isolate Unclassified
104 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
105 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
106 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
107 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
108 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 87.16
Metatranscriptomes 0.68
Isolates 12.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.68
Bulb 0
Endosphere 1.35
Nodule 1.35
Rhizoplane 11.49
Rhizosphere 68.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0205818 3300048912 Bacteria 1850
2 Ga0068856_100030008 3300005614 Bacteria 5314
3 Ga0068852_100282761 3300005616 Bacteria 1600
4 Ga0068859_100015058 3300005617 Bacteria 7765
5 Ga0081455_10008500 3300005937 Bacteria 10665
6 Ga0075428_100000728 3300006844 Bacteria 34185
7 Ga0075428_100005670 3300006844 Bacteria 13876
8 Ga0075430_100003510 3300006846 Bacteria 13124
9 Ga0075430_100006316 3300006846 Bacteria 9996
10 Ga0075431_100007958 3300006847 Bacteria 10569
11 Ga0075431_100012204 3300006847 Bacteria 8672
12 Ga0075429_100001092 3300006880 Bacteria 21833
13 Ga0075429_100023032 3300006880 Bacteria 5398
14 Ga0097620_100015058 3300006931 Bacteria 7765
15 Ga0105240_10104997 3300009093 Bacteria 3430
16 Ga0114129_10000988 3300009147 Bacteria 37163
17 Ga0105243_10001854 3300009148 Bacteria 18042
18 Ga0105248_10004626 3300009177 Bacteria 15220
19 Ga0157369_10082955 3300013105 Bacteria 3429
20 Ga0206353_10750942 3300020082 Bacteria 3729
21 Ga0207671_10078503 3300025914 Bacteria 2472
22 Ga0207687_10061028 3300025927 Bacteria 2661
23 Ga0207700_10184711 3300025928 Bacteria 1748
24 Ga0207709_10001086 3300025935 Bacteria 19966
25 Ga0207669_10070243 3300025937 Bacteria 2195
26 Ga0207711_10003976 3300025941 Bacteria 12713
27 Ga0207667_10045812 3300025949 Bacteria 4631
28 Ga0207677_10189628 3300026023 Bacteria 1625
29 Ga0207698_10004875 3300026142 Bacteria 8225
30 Ga0307515_10005482 3300028794 Bacteria 25691
31 Ga0307515_10045520 3300028794 Bacteria 6738
32 Ga0307512_10003907 3300030522 Bacteria 16730
33 Ga0307512_10016553 3300030522 Bacteria 6803
34 Ga0307513_10026947 3300031456 Bacteria 6611
35 Ga0307508_10058106 3300031616 Bacteria 3423
36 Ga0307516_10007675 3300031730 Bacteria 12346
37 Ga0373956_0000407 3300035119 Bacteria 17450
38 Ga0373956_0000410 3300035119 Bacteria 17403
39 Ga0373927_0035499 3300035695 Bacteria 3242
40 Ga0436364_0417518 3300037853 Bacteria 5822
41 Ga0436364_0936362 3300037853 Bacteria 7384
42 Ga0436365_0614140 3300039437 Bacteria 4300
43 Ga0436362_0839712 3300039453 Bacteria 37440
44 Ga0451791_0215498 3300041451 Bacteria 5351
45 Ga0451793_1898960 3300041452 Bacteria 2566
46 Ga0451853_2248584 3300041512 Bacteria 3725
47 Ga0466969_0028340 3300044656 Bacteria 2863
48 Ga0466966_0003340 3300044684 Bacteria 10578
49 Ga0466966_0055828 3300044684 Bacteria 2499
50 Ga0466966_0056144 3300044684 Bacteria 2492
51 Ga0466961_0002173 3300044693 Bacteria 12205
52 Ga0466963_0032557 3300044694 Bacteria 3377
53 Ga0466963_0088282 3300044694 Bacteria 2109
54 Ga0466963_0158604 3300044694 Bacteria 1574
55 Ga0466964_0060953 3300044706 Bacteria 1570
56 Ga0466971_0028525 3300044719 Bacteria 2497
57 Ga0466970_0007587 3300044765 Bacteria 5438
58 Ga0466970_0009362 3300044765 Bacteria 4949
59 Ga0466970_0028445 3300044765 Bacteria 2937
60 Ga0466957_0061626 3300044842 Bacteria 2303
61 Ga0466957_0172817 3300044842 Bacteria 1408
62 Ga0466959_0008558 3300045049 Bacteria 7241
63 Ga0466959_0015056 3300045049 Bacteria 5633
64 Ga0466959_0035057 3300045049 Bacteria 3712
65 Ga0466959_0105203 3300045049 Bacteria 2018
66 Ga0466958_0012872 3300045836 Bacteria 4748
67 Ga0466958_0028336 3300045836 Bacteria 3320
68 Ga0466958_0090713 3300045836 Bacteria 1891
69 Ga0466967_0000224 3300045976 Bacteria 24348
70 Ga0466967_0001275 3300045976 Bacteria 14307
71 Ga0466967_0002992 3300045976 Bacteria 10825
72 Ga0466967_0005402 3300045976 Bacteria 8848
73 Ga0466967_0049755 3300045976 Bacteria 3667
74 Ga0466967_0058748 3300045976 Bacteria 3401
75 Ga0466967_0069303 3300045976 Bacteria 3152
76 Ga0466967_0107771 3300045976 Bacteria 2556
77 Ga0466967_0139209 3300045976 Bacteria 2259
78 Ga0495629_0123557 3300046459 Bacteria 1803
79 Ga0495606_0001559 3300046507 Bacteria 30113
80 Ga0495665_0015509 3300046531 Bacteria 4104
81 Ga0495668_0000043 3300046616 Bacteria 227636
82 Ga0495668_0000173 3300046616 Bacteria 95830
83 Ga0495625_0001109 3300046660 Bacteria 34897
84 Ga0495602_0117174 3300048088 Bacteria 2151
85 Ga0495626_0000267 3300048091 Bacteria 58992
86 Ga0496102_0000090 3300048905 Bacteria 127346
87 Ga0496102_0008346 3300048905 Bacteria 8871
88 Ga0496102_0354558 3300048905 Bacteria 1381
89 Ga0496103_0000034 3300048906 Bacteria 189284
90 Ga0496104_0006734 3300048907 Bacteria 10120
91 Ga0496105_0024418 3300048908 Bacteria 4910
92 Ga0496108_0000936 3300048911 Bacteria 22763
93 Ga0496108_0037355 3300048911 Bacteria 4045
94 Ga0496109_0001019 3300048912 Bacteria 23150
95 Ga0496110_0000725 3300048913 Bacteria 22809
96 Ga0496111_0000681 3300048914 Bacteria 17864
97 Ga0496113_0025634 3300048916 Bacteria 4206
98 Ga0496114_0016441 3300048917 Bacteria 5963
99 Ga0496114_0144904 3300048917 Bacteria 2058
100 Ga0496118_0015101 3300048921 Bacteria 7175
101 Ga0496118_0032646 3300048921 Bacteria 4283
102 Ga0496119_0041771 3300048922 Bacteria 2915
103 Ga0496121_0040288 3300048924 Bacteria 4101
104 Ga0496126_0032302 3300048929 Bacteria 4932
105 Ga0501031_0040914 3300049568 Bacteria 3025
106 Ga0501032_0095103 3300049569 Bacteria 1975
107 Ga0501034_0022833 3300049571 Bacteria 6373
108 Ga0501034_0043372 3300049571 Bacteria 4553
109 Ga0501036_0000374 3300049572 Bacteria 31562
110 Ga0501037_0034256 3300049573 Bacteria 3747
111 Ga0501038_0001921 3300049574 Bacteria 19179
112 Ga0501038_0016496 3300049574 Bacteria 6694
113 Ga0501042_0056513 3300049578 Bacteria 2800
114 Ga0501043_0005237 3300049579 Bacteria 10484
115 Ga0501043_0027086 3300049579 Bacteria 4499
116 Ga0501047_0013281 3300049581 Bacteria 7800
117 Ga0501048_0001498 3300049582 Bacteria 17679
118 Ga0501048_0012285 3300049582 Bacteria 6373
119 Ga0501070_0125947 3300049586 Bacteria 2117
120 Ga0501081_0028938 3300049743 Bacteria 3741
121 Ga0501035_0018993 3300049822 Bacteria 6328
122 Ga0501044_0006581 3300049823 Bacteria 12824
123 nmdc:mga03n38_39053_c1 3300050490 Bacteria 2057
124 nmdc:mga07m45_25367_c1 3300050496 Bacteria 3251
125 nmdc:mga05p37_1362_c2 3300050507 Bacteria 7174
126 nmdc:mga05p37_29040_c1 3300050507 Bacteria 6749
127 nmdc:mga09592_72_c1 3300050508 Bacteria 56957
128 nmdc:mga0qj67_48_c1 3300050509 Bacteria 85487
129 nmdc:mga06r32_436_c1 3300050510 Bacteria 35325
130 Ga0466962_0037617 3300061719 Bacteria 2317
131 2558907606 2558860112 Bacteria 9931328
132 2566996933 2565956761 Bacteria 6601618
133 2676205287 2675902999 Bacteria 9438463
134 2738889849 2738541308 Bacteria 7020677
135 2739203466 2738543005 Bacteria 5278128
136 2739238345 2738543011 Bacteria 5731169
137 2774849862 2773857921 Bacteria 9435764
138 2791913355 2791354901 Bacteria 8322202
139 2887480927 2887478801 Bacteria 8972725
140 2889302305 2889300758 Bacteria 5690814
141 2899366476 2899359706 Bacteria 10940472
142 2904539919 2904535858 Bacteria 6308016
143 2922560493 2922554459 Bacteria 6683962
144 2928146184 2928142448 Bacteria 5288925
145 2932398682 2932398195 Bacteria 3847976
146 2939748268 2939743619 Bacteria 5762299
147 2974316969 2974315732 Bacteria 4602776
148 2984525156 2984523437 Bacteria 4508481
149 Ga0496109_0205818
150 Ga0068856_100030008
151 Ga0068852_100282761
152 Ga0068859_100015058
153 Ga0081455_10008500
154 Ga0075428_100000728
155 Ga0075428_100005670
156 Ga0075430_100003510
157 Ga0075430_100006316
158 Ga0075431_100007958
159 Ga0075431_100012204
160 Ga0075429_100001092
161 Ga0075429_100023032
162 Ga0097620_100015058
163 Ga0105240_10104997
164 Ga0114129_10000988
165 Ga0105243_10001854
166 Ga0105248_10004626
167 Ga0157369_10082955
168 Ga0206353_10750942
169 Ga0207671_10078503
170 Ga0207687_10061028
171 Ga0207700_10184711
172 Ga0207709_10001086
173 Ga0207669_10070243
174 Ga0207711_10003976
175 Ga0207667_10045812
176 Ga0207677_10189628
177 Ga0207698_10004875
178 Ga0307515_10005482
179 Ga0307515_10045520
180 Ga0307512_10003907
181 Ga0307512_10016553
182 Ga0307513_10026947
183 Ga0307508_10058106
184 Ga0307516_10007675
185 Ga0373956_0000407
186 Ga0373956_0000410
187 Ga0373927_0035499
188 Ga0436364_0417518
189 Ga0436364_0936362
190 Ga0436365_0614140
191 Ga0436362_0839712
192 Ga0451791_0215498
193 Ga0451793_1898960
194 Ga0451853_2248584
195 Ga0466969_0028340
196 Ga0466966_0003340
197 Ga0466966_0055828
198 Ga0466966_0056144
199 Ga0466961_0002173
200 Ga0466963_0032557
201 Ga0466963_0088282
202 Ga0466963_0158604
203 Ga0466964_0060953
204 Ga0466971_0028525
205 Ga0466970_0007587
206 Ga0466970_0009362
207 Ga0466970_0028445
208 Ga0466957_0061626
209 Ga0466957_0172817
210 Ga0466959_0008558
211 Ga0466959_0015056
212 Ga0466959_0035057
213 Ga0466959_0105203
214 Ga0466958_0012872
215 Ga0466958_0028336
216 Ga0466958_0090713
217 Ga0466967_0000224
218 Ga0466967_0001275
219 Ga0466967_0002992
220 Ga0466967_0005402
221 Ga0466967_0049755
222 Ga0466967_0058748
223 Ga0466967_0069303
224 Ga0466967_0107771
225 Ga0466967_0139209
226 Ga0495629_0123557
227 Ga0495606_0001559
228 Ga0495665_0015509
229 Ga0495668_0000043
230 Ga0495668_0000173
231 Ga0495625_0001109
232 Ga0495602_0117174
233 Ga0495626_0000267
234 Ga0496102_0000090
235 Ga0496102_0008346
236 Ga0496102_0354558
237 Ga0496103_0000034
238 Ga0496104_0006734
239 Ga0496105_0024418
240 Ga0496108_0000936
241 Ga0496108_0037355
242 Ga0496109_0001019
243 Ga0496110_0000725
244 Ga0496111_0000681
245 Ga0496113_0025634
246 Ga0496114_0016441
247 Ga0496114_0144904
248 Ga0496118_0015101
249 Ga0496118_0032646
250 Ga0496119_0041771
251 Ga0496121_0040288
252 Ga0496126_0032302
253 Ga0501031_0040914
254 Ga0501032_0095103
255 Ga0501034_0022833
256 Ga0501034_0043372
257 Ga0501036_0000374
258 Ga0501037_0034256
259 Ga0501038_0001921
260 Ga0501038_0016496
261 Ga0501042_0056513
262 Ga0501043_0005237
263 Ga0501043_0027086
264 Ga0501047_0013281
265 Ga0501048_0001498
266 Ga0501048_0012285
267 Ga0501070_0125947
268 Ga0501081_0028938
269 Ga0501035_0018993
270 Ga0501044_0006581
271 nmdc:mga03n38_39053_c1
272 nmdc:mga07m45_25367_c1
273 nmdc:mga05p37_1362_c2
274 nmdc:mga05p37_29040_c1
275 nmdc:mga09592_72_c1
276 nmdc:mga0qj67_48_c1
277 nmdc:mga06r32_436_c1
278 Ga0466962_0037617
279 2558907606
280 2566996933
281 2676205287
282 2738889849
283 2739203466
284 2739238345
285 2774849862
286 2791913355
287 2887480927
288 2889302305
289 2899366476
290 2904539919
291 2922560493
292 2928146184
293 2932398682
294 2939748268
295 2974316969
296 2984525156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01039

Carboxyl_trans

Carboxyl transferase domain

6

444

0.95

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

214

437

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l6w-assembly1.cif.gz_B carboxyltransferase subunit (accd6) of mycobacterium tuberculosis acetyl-coa carboxylase 0.9672 15 460
4l6w-assembly1.cif.gz_A carboxyltransferase subunit (accd6) of mycobacterium tuberculosis acetyl-coa carboxylase 0.965 15 460
4l6w-assembly1.cif.gz_A carboxyltransferase subunit (accd6) of mycobacterium tuberculosis acetyl-coa carboxylase 0.9604 15 460
6tzv-assembly3.cif.gz_E crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis 0.9589 13 464
4l6w-assembly1.cif.gz_B carboxyltransferase subunit (accd6) of mycobacterium tuberculosis acetyl-coa carboxylase 0.9584 15 460
ID Description Score Start End Superfamily
4fb8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9734 14 216 3.90.226.10
4fb8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9633 14 216 3.90.226.10
4l6wA02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9613 226 460 3.90.226.10
af_Q20676_22_285_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9499 17 208 3.90.226.10
af_O86318_1_265_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9474 17 210 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A1X7T916-F1-model_v4 Propionyl-CoA carboxylase beta chain, mitochondrial (EC 6.4.1.3) (Propanoyl-CoA:carbon dioxide ligase subunit beta) 0.9946 40 134 GO:0004658
GO:0005739
AF-A0A0M8SWB9-F1-model_v4 Methylmalonyl-CoA carboxyltransferase 0.9835 54 145 GO:0004658
GO:0009317
GO:0016740
AF-A0A7K1EF39-F1-model_v4 deleted 0.9745 11 175
AF-A0A6P0EMC7-F1-model_v4 deleted 0.9724 38 118
AF-A0A5C8PXI7-F1-model_v4 Methylmalonyl-CoA carboxyltransferase 0.9704 76 161 GO:0004658
GO:0009317
GO:0016740

Map