F202848

General Info

Members Datasets Scaffolds Average Seq Length
148 72 148 227

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100083374|Ga0075428_1000833745
Length 251
Sequence MHELEFLNQEIIACRKCARLVAWREEVALVKRKAYRDQEYWGKPVPGFGDQKARVLVVGLAPGAHGSNRTGRAFTGDASGGFLYPALHRAGFANQSTAESRSDGLRLMDLYIAASARCVPPDNKPSPDELDNCQPYLEREIQILKPKVIVCLGRIAFDRLLKIYSAALTPALSPLRLHGQLAAAPSSAPSLSASGRRRKWKFGHGASYRLENGTWILCSYHPSQQNTLTGKLTVKMFDDIWRKAKELIHDQ

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
39 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
49 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
50 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
57 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
58 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
61 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
62 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
63 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
64 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
65 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
66 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
67 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
68 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
69 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
70 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
71 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
72 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.35
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1308774 2162886006 Bacteria 1842
2 SwRhRL3b_contig_191909 2162886006 Bacteria 903
3 JGI25406J46586_10008270 3300003203 Bacteria 4722
4 JGI25406J46586_10008840 3300003203 Bacteria 4536
5 Ga0065704_10000294 3300005289 Bacteria 47445
6 Ga0065704_10089066 3300005289 Unclassified 2888
7 Ga0065707_10000503 3300005295 Bacteria 28730
8 Ga0065707_10083395 3300005295 Bacteria 9332
9 Ga0065707_10109954 3300005295 Bacteria 2449
10 Ga0065707_10211191 3300005295 Bacteria 1265
11 Ga0070680_100721992 3300005336 Unclassified 857
12 Ga0070689_100619507 3300005340 Bacteria 939
13 Ga0070687_100395080 3300005343 Unclassified 905
14 Ga0070706_100008474 3300005467 Bacteria 9578
15 Ga0070707_100017287 3300005468 Bacteria 6780
16 Ga0070707_100231818 3300005468 Bacteria 1797
17 Ga0070698_100110863 3300005471 Unclassified 2709
18 Ga0070698_100402419 3300005471 Bacteria 1302
19 Ga0070699_100155528 3300005518 Bacteria 2023
20 Ga0070704_100272476 3300005549 Unclassified 1399
21 Ga0068859_100328888 3300005617 Bacteria 1622
22 Ga0068862_100044985 3300005844 Bacteria 3766
23 Ga0068862_100408467 3300005844 Unclassified 1271
24 Ga0081455_10044247 3300005937 Bacteria 3887
25 Ga0081538_10000712 3300005981 Bacteria 36271
26 Ga0081538_10003641 3300005981 Bacteria 14489
27 Ga0081538_10017731 3300005981 Bacteria 5386
28 Ga0081539_10002974 3300005985 Bacteria 22229
29 Ga0081539_10045925 3300005985 Bacteria 2507
30 Ga0075428_100083374 3300006844 Bacteria 3488
31 Ga0075430_100077164 3300006846 Bacteria 2792
32 Ga0075430_100155771 3300006846 Bacteria 1902
33 Ga0075430_100331510 3300006846 Bacteria 1257
34 Ga0075431_100035741 3300006847 Bacteria 5116
35 Ga0075434_100204257 3300006871 Bacteria 1996
36 Ga0075429_100007125 3300006880 Bacteria 9712
37 Ga0075429_100019605 3300006880 Bacteria 5863
38 Ga0075429_100037025 3300006880 Unclassified 4246
39 Ga0075429_100536806 3300006880 Bacteria 1025
40 Ga0097620_100328876 3300006931 Bacteria 1622
41 Ga0111539_10106015 3300009094 Unclassified 3297
42 Ga0111539_10197966 3300009094 Bacteria 2344
43 Ga0114129_10000808 3300009147 Bacteria 40249
44 Ga0114129_10034912 3300009147 Bacteria 7104
45 Ga0114129_10044588 3300009147 Bacteria 6238
46 Ga0114129_10125363 3300009147 Bacteria 3531
47 Ga0114129_10372283 3300009147 Bacteria 1888
48 Ga0114129_11229847 3300009147 Unclassified 931
49 Ga0105243_10078651 3300009148 Bacteria 2686
50 Ga0105241_10341456 3300009174 Unclassified 1297
51 Ga0105249_10059608 3300009553 Unclassified 3501
52 Ga0105249_10214246 3300009553 Bacteria 1892
53 Ga0157380_10541406 3300014326 Unclassified 1140
54 Ga0207684_10007744 3300025910 Bacteria 9617
55 Ga0207662_10158720 3300025918 Unclassified 1443
56 Ga0207646_10141282 3300025922 Unclassified 2169
57 Ga0207670_10322316 3300025936 Bacteria 1216
58 Ga0207712_10019919 3300025961 Unclassified 4388
59 Ga0207674_10189608 3300026116 Bacteria 2006
60 Ga0207675_100103590 3300026118 Bacteria 2682
61 Ga0268265_10020346 3300028380 Unclassified 4631
62 Ga0268265_10051666 3300028380 Bacteria 3104
63 Ga0268265_10424975 3300028380 Bacteria 1235
64 Ga0265330_10027941 3300031235 Bacteria 2546
65 Ga0265329_10023754 3300031242 Bacteria 2039
66 Ga0265316_10111033 3300031344 Bacteria 2076
67 Ga0316579_10036022 3300031691 Unclassified 2282
68 Ga0265314_10039436 3300031711 Bacteria 3402
69 Ga0307405_10736570 3300031731 Bacteria 820
70 Ga0307410_10545059 3300031852 Bacteria 961
71 Ga0307410_10767945 3300031852 Unclassified 817
72 Ga0307407_10393792 3300031903 Bacteria 992
73 Ga0307409_100078178 3300031995 Bacteria 2661
74 Ga0307409_100520838 3300031995 Bacteria 1162
75 Ga0307416_100080788 3300032002 Bacteria 2746
76 Ga0316582_0012651 3300036647 Bacteria 4718
77 Ga0316584_0098900 3300036712 Unclassified 2184
78 Ga0316581_0014715 3300037588 Unclassified 2229
79 Ga0436364_0790027 3300037853 Bacteria 2554
80 Ga0451800_1500981 3300041459 Bacteria 1145
81 Ga0451577_0008628 3300042876 Bacteria 9901
82 Ga0451577_0013524 3300042876 Bacteria 7633
83 Ga0451577_0021444 3300042876 Bacteria 5913
84 Ga0451577_0043157 3300042876 Bacteria 4039
85 Ga0451577_0049542 3300042876 Bacteria 3751
86 Ga0451577_0076581 3300042876 Bacteria 2982
87 Ga0451577_0092817 3300042876 Unclassified 2695
88 Ga0451577_0301700 3300042876 Unclassified 1451
89 Ga0451577_0305528 3300042876 Bacteria 1441
90 Ga0453683_0000444 3300044673 Bacteria 47621
91 Ga0453683_0004040 3300044673 Bacteria 10573
92 Ga0453683_0027611 3300044673 Bacteria 3597
93 Ga0453683_0051631 3300044673 Bacteria 2575
94 Ga0453683_0074655 3300044673 Unclassified 2123
95 Ga0453683_0094924 3300044673 Bacteria 1871
96 Ga0453683_0212570 3300044673 Bacteria 1229
97 Ga0453684_0000044 3300044712 Bacteria 585643
98 Ga0453684_0000095 3300044712 Bacteria 378681
99 Ga0453684_0000640 3300044712 Bacteria 126342
100 Ga0453684_0006161 3300044712 Bacteria 23065
101 Ga0453684_0006303 3300044712 Bacteria 22669
102 Ga0453684_0025469 3300044712 Bacteria 8589
103 Ga0453684_0033102 3300044712 Bacteria 7212
104 Ga0453684_0049446 3300044712 Bacteria 5545
105 Ga0453684_0055312 3300044712 Bacteria 5160
106 Ga0453684_0059376 3300044712 Bacteria 4931
107 Ga0453684_0070257 3300044712 Bacteria 4435
108 Ga0453684_0094702 3300044712 Bacteria 3673
109 Ga0453684_0103534 3300044712 Bacteria 3478
110 Ga0453684_0182222 3300044712 Bacteria 2464
111 Ga0453684_0246500 3300044712 Bacteria 2054
112 Ga0453684_0246821 3300044712 Bacteria 2052
113 Ga0453684_0523330 3300044712 Bacteria 1310
114 Ga0453684_0537016 3300044712 Unclassified 1290
115 Ga0453684_0572467 3300044712 Unclassified 1241
116 Ga0453684_0951549 3300044712 Bacteria 916
117 Ga0451576_0000454 3300045051 Bacteria 93047
118 Ga0451576_0007498 3300045051 Bacteria 13018
119 Ga0451576_0015916 3300045051 Bacteria 8315
120 Ga0451576_0113539 3300045051 Bacteria 2820
121 Ga0451576_0201714 3300045051 Unclassified 2077
122 Ga0451576_0258189 3300045051 Unclassified 1821
123 Ga0496106_0499878 3300048909 Bacteria 977
124 Ga0501039_0181918 3300049575 Unclassified 1653
125 Ga0501040_0443070 3300049576 Bacteria 935
126 Ga0501074_0087236 3300049590 Bacteria 2235
127 Ga0501075_0043276 3300049591 Bacteria 3377
128 Ga0501075_0151148 3300049591 Bacteria 1770
129 Ga0501076_0116698 3300049592 Bacteria 2160
130 Ga0501076_0597869 3300049592 Unclassified 910
131 Ga0501080_0159147 3300049742 Bacteria 2086
132 Ga0501081_0483097 3300049743 Unclassified 922
133 nmdc:mga05p37_1190894_c1 3300050507 Bacteria 788
134 nmdc:mga05p37_27298_c1 3300050507 Bacteria 6951
135 nmdc:mga05p37_661_c1 3300050507 Bacteria 38042
136 nmdc:mga09592_10724_c1 3300050508 Bacteria 7460
137 nmdc:mga09592_8530_c1 3300050508 Bacteria 8336
138 nmdc:mga09592_998806_c1 3300050508 Bacteria 700
139 nmdc:mga0qj67_230202_c1 3300050509 Bacteria 1504
140 nmdc:mga0qj67_61897_c1 3300050509 Bacteria 2972
141 nmdc:mga06r32_310346_c1 3300050510 Bacteria 1563
142 nmdc:mga08y16_137666_c1 3300050511 Bacteria 2538
143 nmdc:mga08y16_219554_c1 3300050511 Bacteria 1968
144 nmdc:mga08y16_53071_c1 3300050511 Unclassified 4240
145 nmdc:mga0n895_180982_c1 3300050512 Bacteria 2139
146 Ga0501084_0021062 3300054114 Bacteria 5438
147 Ga0501082_0117506 3300060353 Bacteria 2304
148 Ga0501082_0889559 3300060353 Unclassified 779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10106015 Ga0111539_101060153 194
2 3300032002 Ga0307416_100080788 Ga0307416_1000807882 196
3 3300042876 Ga0451577_0021444 Ga0451577_0021444_4378_4989 197
4 3300044673 Ga0453683_0051631 Ga0453683_0051631_1039_1650 197
5 3300044712 Ga0453684_0059376 Ga0453684_0059376_1574_2185 197
6 3300044712 Ga0453684_0182222 Ga0453684_0182222_132_743 197
7 3300044712 Ga0453684_0033102 Ga0453684_0033102_1582_2217 200
8 3300050508 nmdc:mga09592_998806_c1 nmdc:mga09592_998806_c1_31_690 202
9 3300031235 Ga0265330_10027941 Ga0265330_100279413 211
10 3300031242 Ga0265329_10023754 Ga0265329_100237542 211
11 3300031344 Ga0265316_10111033 Ga0265316_101110332 211
12 3300031711 Ga0265314_10039436 Ga0265314_100394362 211
13 3300044712 Ga0453684_0951549 Ga0453684_0951549_56_706 213
14 3300042876 Ga0451577_0301700 Ga0451577_0301700_369_1037 216
15 3300044712 Ga0453684_0000044 Ga0453684_0000044_188674_189339 216
16 3300009094 Ga0111539_10197966 Ga0111539_101979664 217
17 3300044712 Ga0453684_0006161 Ga0453684_0006161_15558_16229 217
18 3300045051 Ga0451576_0007498 Ga0451576_0007498_6072_6779 217
19 3300042876 Ga0451577_0043157 Ga0451577_0043157_2200_2856 218
20 3300044712 Ga0453684_0000095 Ga0453684_0000095_121198_121854 218
21 3300009147 Ga0114129_10125363 Ga0114129_101253633 219
22 3300042876 Ga0451577_0049542 Ga0451577_0049542_908_1567 219
23 3300044712 Ga0453684_0006303 Ga0453684_0006303_17117_17776 219
24 3300044712 Ga0453684_0572467 Ga0453684_0572467_96_776 219
25 3300060353 Ga0501082_0889559 Ga0501082_0889559_108_767 219
26 3300005295 Ga0065707_10083395 Ga0065707_100833955 220
27 3300005471 Ga0070698_100110863 Ga0070698_1001108631 220
28 3300006846 Ga0075430_100331510 Ga0075430_1003315101 221
29 3300031691 Ga0316579_10036022 Ga0316579_100360222 221
30 3300036647 Ga0316582_0012651 Ga0316582_0012651_2296_3006 221
31 3300036712 Ga0316584_0098900 Ga0316584_0098900_1163_1873 221
32 3300037588 Ga0316581_0014715 Ga0316581_0014715_1251_1961 221
33 3300037853 Ga0436364_0790027 Ga0436364_0790027_291_995 221
34 3300042876 Ga0451577_0305528 Ga0451577_0305528_246_911 221
35 3300044712 Ga0453684_0000640 Ga0453684_0000640_108890_109597 221
36 3300044712 Ga0453684_0049446 Ga0453684_0049446_61_726 221
37 3300044712 Ga0453684_0094702 Ga0453684_0094702_284_970 221
38 3300044712 Ga0453684_0103534 Ga0453684_0103534_1805_2506 221
39 3300050511 nmdc:mga08y16_53071_c1 nmdc:mga08y16_53071_c1_2630_3319 221
40 3300005549 Ga0070704_100272476 Ga0070704_1002724763 222
41 3300005844 Ga0068862_100408467 Ga0068862_1004084672 222
42 3300005981 Ga0081538_10000712 Ga0081538_100007129 222
43 3300005981 Ga0081538_10003641 Ga0081538_1000364114 222
44 3300005981 Ga0081538_10017731 Ga0081538_100177312 222
45 3300006844 Ga0075428_100083374 Ga0075428_1000833745 222
46 3300006880 Ga0075429_100037025 Ga0075429_1000370252 222
47 3300009147 Ga0114129_10044588 Ga0114129_100445888 222
48 3300026116 Ga0207674_10189608 Ga0207674_101896082 222
49 3300026118 Ga0207675_100103590 Ga0207675_1001035905 222
50 3300028380 Ga0268265_10051666 Ga0268265_100516663 222
51 3300041459 Ga0451800_1500981 Ga0451800_1500981_357_1028 222
52 3300050511 nmdc:mga08y16_137666_c1 nmdc:mga08y16_137666_c1_1286_1990 222
53 3300003203 JGI25406J46586_10008270 JGI25406J46586_100082702 223
54 3300003203 JGI25406J46586_10008840 JGI25406J46586_100088404 223
55 3300005295 Ga0065707_10109954 Ga0065707_101099545 223
56 3300005340 Ga0070689_100619507 Ga0070689_1006195071 223
57 3300005467 Ga0070706_100008474 Ga0070706_1000084747 223
58 3300005468 Ga0070707_100017287 Ga0070707_1000172875 223
59 3300005468 Ga0070707_100231818 Ga0070707_1002318183 223
60 3300005471 Ga0070698_100402419 Ga0070698_1004024192 223
61 3300005518 Ga0070699_100155528 Ga0070699_1001555282 223
62 3300005617 Ga0068859_100328888 Ga0068859_1003288882 223
63 3300005844 Ga0068862_100044985 Ga0068862_1000449854 223
64 3300005985 Ga0081539_10002974 Ga0081539_100029741 223
65 3300006846 Ga0075430_100077164 Ga0075430_1000771642 223
66 3300006847 Ga0075431_100035741 Ga0075431_1000357412 223
67 3300006880 Ga0075429_100536806 Ga0075429_1005368062 223
68 3300006931 Ga0097620_100328876 Ga0097620_1003288762 223
69 3300009553 Ga0105249_10059608 Ga0105249_100596085 223
70 3300025910 Ga0207684_10007744 Ga0207684_100077447 223
71 3300025936 Ga0207670_10322316 Ga0207670_103223162 223
72 3300025961 Ga0207712_10019919 Ga0207712_100199192 223
73 3300028380 Ga0268265_10020346 Ga0268265_100203462 223
74 3300031852 Ga0307410_10767945 Ga0307410_107679451 223
75 3300031903 Ga0307407_10393792 Ga0307407_103937921 223
76 3300031995 Ga0307409_100078178 Ga0307409_1000781783 223
77 3300042876 Ga0451577_0008628 Ga0451577_0008628_3272_3979 223
78 3300042876 Ga0451577_0013524 Ga0451577_0013524_975_1646 223
79 3300042876 Ga0451577_0092817 Ga0451577_0092817_1223_1894 223
80 3300044673 Ga0453683_0004040 Ga0453683_0004040_4686_5360 223
81 3300044673 Ga0453683_0027611 Ga0453683_0027611_531_1205 223
82 3300044673 Ga0453683_0212570 Ga0453683_0212570_46_717 223
83 3300044712 Ga0453684_0025469 Ga0453684_0025469_7308_7991 223
84 3300044712 Ga0453684_0055312 Ga0453684_0055312_365_1036 223
85 3300044712 Ga0453684_0070257 Ga0453684_0070257_2240_2911 223
86 3300044712 Ga0453684_0246500 Ga0453684_0246500_44_718 223
87 3300044712 Ga0453684_0246821 Ga0453684_0246821_391_1062 223
88 3300045051 Ga0451576_0000454 Ga0451576_0000454_59383_60102 223
89 3300045051 Ga0451576_0015916 Ga0451576_0015916_4678_5349 223
90 3300045051 Ga0451576_0201714 Ga0451576_0201714_1345_2019 223
91 3300050509 nmdc:mga0qj67_230202_c1 nmdc:mga0qj67_230202_c1_321_992 223
92 3300050510 nmdc:mga06r32_310346_c1 nmdc:mga06r32_310346_c1_332_1054 223
93 3300050511 nmdc:mga08y16_219554_c1 nmdc:mga08y16_219554_c1_575_1246 223
94 3300014326 Ga0157380_10541406 Ga0157380_105414062 224
95 3300044673 Ga0453683_0000444 Ga0453683_0000444_46068_46766 224
96 3300044712 Ga0453684_0537016 Ga0453684_0537016_59_772 224
97 2162886006 SwRhRL3b_contig_1308774 SwRhRL3b_0932.00001360 225
98 2162886006 SwRhRL3b_contig_191909 SwRhRL3b_0860.00001720 225
99 3300005289 Ga0065704_10000294 Ga0065704_1000029426 225
100 3300005289 Ga0065704_10089066 Ga0065704_100890662 225
101 3300005295 Ga0065707_10000503 Ga0065707_1000050329 225
102 3300005295 Ga0065707_10211191 Ga0065707_102111911 225
103 3300005336 Ga0070680_100721992 Ga0070680_1007219921 225
104 3300005343 Ga0070687_100395080 Ga0070687_1003950801 225
105 3300005937 Ga0081455_10044247 Ga0081455_100442479 225
106 3300005985 Ga0081539_10045925 Ga0081539_100459252 225
107 3300006846 Ga0075430_100155771 Ga0075430_1001557712 225
108 3300006871 Ga0075434_100204257 Ga0075434_1002042572 225
109 3300006880 Ga0075429_100007125 Ga0075429_1000071256 225
110 3300006880 Ga0075429_100019605 Ga0075429_1000196054 225
111 3300009147 Ga0114129_10000808 Ga0114129_1000080845 225
112 3300009147 Ga0114129_10034912 Ga0114129_100349122 225
113 3300009147 Ga0114129_10372283 Ga0114129_103722831 225
114 3300009147 Ga0114129_11229847 Ga0114129_112298472 225
115 3300009148 Ga0105243_10078651 Ga0105243_100786513 225
116 3300009174 Ga0105241_10341456 Ga0105241_103414562 225
117 3300009553 Ga0105249_10214246 Ga0105249_102142461 225
118 3300025918 Ga0207662_10158720 Ga0207662_101587202 225
119 3300025922 Ga0207646_10141282 Ga0207646_101412822 225
120 3300028380 Ga0268265_10424975 Ga0268265_104249752 225
121 3300031731 Ga0307405_10736570 Ga0307405_107365702 225
122 3300031852 Ga0307410_10545059 Ga0307410_105450591 225
123 3300031995 Ga0307409_100520838 Ga0307409_1005208383 225
124 3300042876 Ga0451577_0076581 Ga0451577_0076581_66_779 225
125 3300044673 Ga0453683_0074655 Ga0453683_0074655_1375_2052 225
126 3300044673 Ga0453683_0094924 Ga0453683_0094924_10_687 225
127 3300044712 Ga0453684_0523330 Ga0453684_0523330_166_843 225
128 3300045051 Ga0451576_0113539 Ga0451576_0113539_1880_2557 225
129 3300045051 Ga0451576_0258189 Ga0451576_0258189_325_1002 225
130 3300048909 Ga0496106_0499878 Ga0496106_0499878_257_934 225
131 3300049575 Ga0501039_0181918 Ga0501039_0181918_605_1282 225
132 3300049576 Ga0501040_0443070 Ga0501040_0443070_208_885 225
133 3300049590 Ga0501074_0087236 Ga0501074_0087236_945_1646 225
134 3300049591 Ga0501075_0043276 Ga0501075_0043276_2560_3261 225
135 3300049591 Ga0501075_0151148 Ga0501075_0151148_256_933 225
136 3300049592 Ga0501076_0116698 Ga0501076_0116698_216_917 225
137 3300049592 Ga0501076_0597869 Ga0501076_0597869_197_880 225
138 3300049742 Ga0501080_0159147 Ga0501080_0159147_1047_1748 225
139 3300049743 Ga0501081_0483097 Ga0501081_0483097_198_899 225
140 3300050507 nmdc:mga05p37_1190894_c1 nmdc:mga05p37_1190894_c1_15_692 225
141 3300050507 nmdc:mga05p37_27298_c1 nmdc:mga05p37_27298_c1_5980_6657 225
142 3300050507 nmdc:mga05p37_661_c1 nmdc:mga05p37_661_c1_5666_6343 225
143 3300050508 nmdc:mga09592_10724_c1 nmdc:mga09592_10724_c1_6513_7190 225
144 3300050508 nmdc:mga09592_8530_c1 nmdc:mga09592_8530_c1_4771_5448 225
145 3300050509 nmdc:mga0qj67_61897_c1 nmdc:mga0qj67_61897_c1_592_1269 225
146 3300050512 nmdc:mga0n895_180982_c1 nmdc:mga0n895_180982_c1_699_1376 225
147 3300054114 Ga0501084_0021062 Ga0501084_0021062_2502_3203 225
148 3300060353 Ga0501082_0117506 Ga0501082_0117506_917_1618 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

46

245

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.9036 1 221
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.8879 1 221
6aaa-assembly1.cif.gz_A structure of a blue-shifted luciferase from amydetes vivianii 0.8261 137 168
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.8159 7 225
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.8059 2 221
ID Description Score Start End Superfamily
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9249 8 221 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9119 1 221 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8959 1 221 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8934 8 221 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8158 7 225 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A7C3LJD5-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9809 69 224 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A7C3LJD5-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9747 69 224 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A645IYQ1-F1-model_v4 Type-5 uracil-DNA glycosylase (EC 3.2.2.-) 0.9708 150 222 GO:0016798
AF-A0A2V9TRW4-F1-model_v4 Uracil-DNA glycosylase 0.9675 79 224 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A7HGT8-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9656 49 221 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
90.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map