F201501

General Info

Members Datasets Scaffolds Average Seq Length
147 116 147 99

Family's Representative Sequence

Representative Sequence 3300049537|Ga0501321_029248|Ga0501321_029248_245_592
Length 115
Sequence MSPEQIIRRPIVLTEKAARLSQQNQVVFEVARDANKIQIRDAVQKLFKVTVTDVNTLVMRGKERRMGRGLAKLQNWKKAIVTLKSGDSIDFFNEVGQPEAASLRKALNDHAAQAI

Samples

Sample ID Description Type Environment
1 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
65 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
74 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
75 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
76 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
77 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
78 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
79 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
80 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
92 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
93 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
101 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.87
Metatranscriptomes 23.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.04
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_10064717 3300004803 Bacteria 587
2 Ga0070658_10248441 3300005327 Bacteria 1509
3 Ga0070683_101096120 3300005329 Bacteria 765
4 Ga0070677_10442938 3300005333 Bacteria 693
5 Ga0070689_101594015 3300005340 Bacteria 593
6 Ga0070687_101541065 3300005343 Bacteria 501
7 Ga0070692_10662890 3300005345 Bacteria 698
8 Ga0070669_101662812 3300005353 Bacteria 556
9 Ga0070674_101709637 3300005356 Bacteria 569
10 Ga0070705_101132607 3300005440 Bacteria 642
11 Ga0070694_101544707 3300005444 Bacteria 562
12 Ga0070708_101759426 3300005445 Bacteria 576
13 Ga0070678_100063732 3300005456 Bacteria 2729
14 Ga0068867_101365974 3300005459 Bacteria 656
15 Ga0070707_100076529 3300005468 Bacteria 3228
16 Ga0070679_102125031 3300005530 Bacteria 511
17 Ga0070684_100046281 3300005535 Bacteria 3769
18 Ga0070704_100673329 3300005549 Bacteria 915
19 Ga0070704_101531438 3300005549 Bacteria 614
20 Ga0068857_100592130 3300005577 Bacteria 1048
21 Ga0068856_100527027 3300005614 Bacteria 1202
22 Ga0068859_101078643 3300005617 Bacteria 883
23 Ga0068860_101767836 3300005843 Bacteria 640
24 Ga0068862_102486472 3300005844 Bacteria 530
25 Ga0070715_10368841 3300006163 Bacteria 789
26 Ga0075428_102153828 3300006844 Unclassified 576
27 Ga0075433_11185628 3300006852 Bacteria 663
28 Ga0075429_100651367 3300006880 Bacteria 923
29 Ga0097620_101078476 3300006931 Bacteria 883
30 Ga0075435_101242203 3300007076 Bacteria 652
31 Ga0105240_10737267 3300009093 Bacteria 1072
32 Ga0111539_10638878 3300009094 Bacteria 1239
33 Ga0105245_11589375 3300009098 Bacteria 705
34 Ga0114129_10221820 3300009147 Bacteria 2550
35 Ga0105242_11475481 3300009176 Bacteria 710
36 Ga0105242_12599602 3300009176 Bacteria 555
37 Ga0105238_10020343 3300009551 Bacteria 6756
38 Ga0105238_11136671 3300009551 Bacteria 804
39 Ga0105239_12058136 3300010375 Bacteria 663
40 Ga0157374_10369216 3300013296 Bacteria 1428
41 Ga0157374_10697985 3300013296 Bacteria 1028
42 Ga0157378_11920241 3300013297 Bacteria 641
43 Ga0163162_11316177 3300013306 Bacteria 821
44 Ga0163162_11364259 3300013306 Bacteria 806
45 Ga0163163_11348597 3300014325 Unclassified 775
46 Ga0157380_10379858 3300014326 Bacteria 1333
47 Ga0157377_11227018 3300014745 Bacteria 582
48 Ga0157377_11628013 3300014745 Bacteria 518
49 Ga0157379_11117206 3300014968 Bacteria 755
50 Ga0213876_10662654 3300021384 Bacteria 555
51 Ga0207705_10243074 3300025909 Bacteria 1371
52 Ga0207695_10561581 3300025913 Bacteria 1023
53 Ga0207646_10094365 3300025922 Bacteria 2679
54 Ga0207681_11345085 3300025923 Bacteria 600
55 Ga0207687_10642205 3300025927 Bacteria 897
56 Ga0207686_10333773 3300025934 Bacteria 1137
57 Ga0207686_10782056 3300025934 Bacteria 764
58 Ga0207670_11323173 3300025936 Bacteria 611
59 Ga0207661_10038767 3300025944 Bacteria 3737
60 Ga0207661_10669798 3300025944 Bacteria 954
61 Ga0207661_10848581 3300025944 Bacteria 841
62 Ga0207667_10589546 3300025949 Bacteria 1122
63 Ga0207702_10732700 3300026078 Bacteria 975
64 Ga0207641_11029748 3300026088 Bacteria 821
65 Ga0207674_10486922 3300026116 Bacteria 1192
66 Ga0207683_10049254 3300026121 Bacteria 3688
67 Ga0316576_11034143 3300031727 Unclassified 584
68 Ga0307406_10105490 3300031901 Bacteria 1928
69 Ga0307412_10010183 3300031911 Bacteria 5410
70 Ga0307412_11251834 3300031911 Bacteria 666
71 Ga0307412_11470200 3300031911 Bacteria 619
72 Ga0307409_100271211 3300031995 Bacteria 1563
73 Ga0307415_100731712 3300032126 Bacteria 896
74 Ga0316596_1122678 3300033541 Bacteria 708
75 Ga0373930_0121551 3300034816 Bacteria 636
76 Ga0373941_0521692 3300035115 Bacteria 508
77 Ga0373931_0616180 3300035691 Bacteria 711
78 Ga0373931_0987573 3300035691 Bacteria 569
79 Ga0373937_2066161 3300036401 Bacteria 516
80 Ga0265778_025931 3300036457 Bacteria 742
81 Ga0265778_037124 3300036457 Bacteria 643
82 Ga0395905_0266979 3300037471 Bacteria 1597
83 Ga0395905_0624293 3300037471 Bacteria 980
84 Ga0436365_0296505 3300039437 Bacteria 1421
85 Ga0436360_0347744 3300039438 Bacteria 946
86 Ga0436360_0871162 3300039438 Bacteria 538
87 Ga0436360_1061694 3300039438 Bacteria 1156
88 Ga0436361_0034741 3300039447 Bacteria 629
89 Ga0436361_1073003 3300039447 Bacteria 586
90 Ga0439436_0102393 3300041404 Bacteria 798
91 Ga0439439_0073647 3300041406 Bacteria 917
92 Ga0439465_0081719 3300041413 Bacteria 1096
93 Ga0439465_0305251 3300041413 Bacteria 596
94 Ga0451802_0092430 3300041460 Bacteria 592
95 Ga0451849_0223424 3300041505 Bacteria 623
96 Ga0439445_0021393 3300042004 Bacteria 1624
97 Ga0450898_092145 3300042134 Bacteria 626
98 Ga0439434_0078585 3300042435 Bacteria 1045
99 Ga0451577_1705064 3300042876 Bacteria 554
100 Ga0453683_0112088 3300044673 Bacteria 1716
101 Ga0466966_0676893 3300044684 Bacteria 622
102 Ga0466964_0361965 3300044706 Bacteria 748
103 Ga0453684_0690978 3300044712 Bacteria 1110
104 Ga0453684_1442363 3300044712 Bacteria 712
105 Ga0466970_0526845 3300044765 Bacteria 682
106 Ga0466959_0679361 3300045049 Bacteria 691
107 Ga0451576_0252568 3300045051 Bacteria 1843
108 Ga0496105_1417391 3300048908 Bacteria 503
109 Ga0496113_0744497 3300048916 Unclassified 781
110 Ga0496122_0047672 3300048925 Bacteria 3306
111 Ga0501297_036506 3300049520 Bacteria 675
112 Ga0501311_011942 3300049527 Bacteria 1077
113 Ga0501320_041783 3300049536 Bacteria 603
114 Ga0501321_021775 3300049537 Bacteria 802
115 Ga0501321_029248 3300049537 Bacteria 728
116 Ga0501324_002582 3300049540 Bacteria 1323
117 Ga0501040_0667008 3300049576 Bacteria 752
118 Ga0501047_0096678 3300049581 Bacteria 2832
119 Ga0501076_1517707 3300049592 Bacteria 550
120 nmdc:mga09592_1716592_c1 3300050508 Bacteria 506
121 nmdc:mga09592_598521_c1 3300050508 Bacteria 945
122 Ga0587084_012799 3300059477 Bacteria 1142
123 Ga0587084_025340 3300059477 Bacteria 919
124 Ga0587093_012944 3300059478 Bacteria 1020
125 Ga0587066_016426 3300059490 Bacteria 1166
126 Ga0587070_029696 3300059491 Bacteria 983
127 Ga0587077_019586 3300059493 Bacteria 1180
128 Ga0587077_021660 3300059493 Bacteria 1143
129 Ga0587077_043322 3300059493 Bacteria 912
130 Ga0587077_146211 3300059493 Bacteria 613
131 Ga0587077_151195 3300059493 Bacteria 607
132 Ga0587085_013393 3300059506 Bacteria 1141
133 Ga0587085_015178 3300059506 Bacteria 1097
134 Ga0587092_025054 3300059512 Bacteria 951
135 Ga0587101_015015 3300059623 Bacteria 1042
136 Ga0587101_041419 3300059623 Bacteria 761
137 Ga0587109_019596 3300059624 Bacteria 1194
138 Ga0587109_026128 3300059624 Bacteria 1078
139 Ga0587109_079803 3300059624 Bacteria 722
140 Ga0587062_043097 3300059639 Bacteria 739
141 Ga0587062_080398 3300059639 Bacteria 605
142 Ga0587068_084283 3300059641 Bacteria 646
143 Ga0587076_011383 3300059645 Bacteria 1306
144 Ga0587079_077237 3300059647 Bacteria 755
145 Ga0587119_041688 3300059658 Bacteria 660
146 Ga0587124_002165 3300059660 Bacteria 1358
147 Ga0466962_0546339 3300061719 Bacteria 588

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061719 Ga0466962_0546339 Ga0466962_0546339_204_500 83
2 3300039438 Ga0436360_0347744 Ga0436360_0347744_651_914 86
3 3300009147 Ga0114129_10221820 Ga0114129_102218202 94
4 3300009551 Ga0105238_10020343 Ga0105238_100203434 94
5 3300031911 Ga0307412_11251834 Ga0307412_112518342 94
6 3300050508 nmdc:mga09592_598521_c1 nmdc:mga09592_598521_c1_260_592 94
7 3300005327 Ga0070658_10248441 Ga0070658_102484412 97
8 3300005329 Ga0070683_101096120 Ga0070683_1010961202 97
9 3300005340 Ga0070689_101594015 Ga0070689_1015940151 97
10 3300005440 Ga0070705_101132607 Ga0070705_1011326072 97
11 3300005444 Ga0070694_101544707 Ga0070694_1015447072 97
12 3300005459 Ga0068867_101365974 Ga0068867_1013659742 97
13 3300005468 Ga0070707_100076529 Ga0070707_1000765295 97
14 3300005549 Ga0070704_101531438 Ga0070704_1015314381 97
15 3300005617 Ga0068859_101078643 Ga0068859_1010786432 97
16 3300006163 Ga0070715_10368841 Ga0070715_103688412 97
17 3300006844 Ga0075428_102153828 Ga0075428_1021538282 97
18 3300006852 Ga0075433_11185628 Ga0075433_111856282 97
19 3300006880 Ga0075429_100651367 Ga0075429_1006513672 97
20 3300006931 Ga0097620_101078476 Ga0097620_1010784762 97
21 3300010375 Ga0105239_12058136 Ga0105239_120581362 97
22 3300013306 Ga0163162_11364259 Ga0163162_113642592 97
23 3300014745 Ga0157377_11628013 Ga0157377_116280131 97
24 3300014968 Ga0157379_11117206 Ga0157379_111172062 97
25 3300021384 Ga0213876_10662654 Ga0213876_106626542 97
26 3300025913 Ga0207695_10561581 Ga0207695_105615812 97
27 3300025922 Ga0207646_10094365 Ga0207646_100943652 97
28 3300025936 Ga0207670_11323173 Ga0207670_113231732 97
29 3300025944 Ga0207661_10669798 Ga0207661_106697982 97
30 3300026088 Ga0207641_11029748 Ga0207641_110297482 97
31 3300034816 Ga0373930_0121551 Ga0373930_0121551_319_615 97
32 3300035115 Ga0373941_0521692 Ga0373941_0521692_46_342 97
33 3300035691 Ga0373931_0616180 Ga0373931_0616180_354_650 97
34 3300035691 Ga0373931_0987573 Ga0373931_0987573_188_484 97
35 3300036401 Ga0373937_2066161 Ga0373937_2066161_114_407 97
36 3300036457 Ga0265778_025931 Ga0265778_025931_125_421 97
37 3300036457 Ga0265778_037124 Ga0265778_037124_219_515 97
38 3300037471 Ga0395905_0624293 Ga0395905_0624293_184_480 97
39 3300039437 Ga0436365_0296505 Ga0436365_0296505_476_769 97
40 3300039438 Ga0436360_0871162 Ga0436360_0871162_157_453 97
41 3300039447 Ga0436361_0034741 Ga0436361_0034741_236_532 97
42 3300041404 Ga0439436_0102393 Ga0439436_0102393_399_695 97
43 3300041406 Ga0439439_0073647 Ga0439439_0073647_227_523 97
44 3300041413 Ga0439465_0081719 Ga0439465_0081719_371_667 97
45 3300042004 Ga0439445_0021393 Ga0439445_0021393_1196_1492 97
46 3300042435 Ga0439434_0078585 Ga0439434_0078585_572_868 97
47 3300044673 Ga0453683_0112088 Ga0453683_0112088_1231_1524 97
48 3300044706 Ga0466964_0361965 Ga0466964_0361965_153_449 97
49 3300044712 Ga0453684_0690978 Ga0453684_0690978_442_738 97
50 3300044765 Ga0466970_0526845 Ga0466970_0526845_126_422 97
51 3300045049 Ga0466959_0679361 Ga0466959_0679361_95_391 97
52 3300045051 Ga0451576_0252568 Ga0451576_0252568_405_701 97
53 3300048916 Ga0496113_0744497 Ga0496113_0744497_441_734 97
54 3300049540 Ga0501324_002582 Ga0501324_002582_282_578 97
55 3300049576 Ga0501040_0667008 Ga0501040_0667008_278_574 97
56 3300049581 Ga0501047_0096678 Ga0501047_0096678_1200_1496 97
57 3300059477 Ga0587084_012799 Ga0587084_012799_519_815 97
58 3300059478 Ga0587093_012944 Ga0587093_012944_320_616 97
59 3300059493 Ga0587077_019586 Ga0587077_019586_528_821 97
60 3300059493 Ga0587077_021660 Ga0587077_021660_439_735 97
61 3300059493 Ga0587077_151195 Ga0587077_151195_250_546 97
62 3300059506 Ga0587085_013393 Ga0587085_013393_437_733 97
63 3300059506 Ga0587085_015178 Ga0587085_015178_353_649 97
64 3300059623 Ga0587101_041419 Ga0587101_041419_249_545 97
65 3300059624 Ga0587109_019596 Ga0587109_019596_518_811 97
66 3300059624 Ga0587109_026128 Ga0587109_026128_646_942 97
67 3300059624 Ga0587109_079803 Ga0587109_079803_27_323 97
68 3300059639 Ga0587062_080398 Ga0587062_080398_269_565 97
69 3300059645 Ga0587076_011383 Ga0587076_011383_363_659 97
70 3300059660 Ga0587124_002165 Ga0587124_002165_606_902 97
71 3300005333 Ga0070677_10442938 Ga0070677_104429382 98
72 3300005345 Ga0070692_10662890 Ga0070692_106628902 98
73 3300005353 Ga0070669_101662812 Ga0070669_1016628122 98
74 3300005445 Ga0070708_101759426 Ga0070708_1017594262 98
75 3300005535 Ga0070684_100046281 Ga0070684_1000462813 98
76 3300005549 Ga0070704_100673329 Ga0070704_1006733292 98
77 3300005843 Ga0068860_101767836 Ga0068860_1017678362 98
78 3300005844 Ga0068862_102486472 Ga0068862_1024864722 98
79 3300007076 Ga0075435_101242203 Ga0075435_1012422032 98
80 3300009093 Ga0105240_10737267 Ga0105240_107372672 98
81 3300009094 Ga0111539_10638878 Ga0111539_106388783 98
82 3300009098 Ga0105245_11589375 Ga0105245_115893752 98
83 3300009176 Ga0105242_12599602 Ga0105242_125996022 98
84 3300009551 Ga0105238_11136671 Ga0105238_111366712 98
85 3300013296 Ga0157374_10697985 Ga0157374_106979852 98
86 3300014325 Ga0163163_11348597 Ga0163163_113485972 98
87 3300014326 Ga0157380_10379858 Ga0157380_103798582 98
88 3300025923 Ga0207681_11345085 Ga0207681_113450851 98
89 3300025934 Ga0207686_10782056 Ga0207686_107820562 98
90 3300025944 Ga0207661_10038767 Ga0207661_100387677 98
91 3300031727 Ga0316576_11034143 Ga0316576_110341431 98
92 3300031901 Ga0307406_10105490 Ga0307406_101054902 98
93 3300031911 Ga0307412_10010183 Ga0307412_100101834 98
94 3300031911 Ga0307412_11470200 Ga0307412_114702002 98
95 3300031995 Ga0307409_100271211 Ga0307409_1002712112 98
96 3300032126 Ga0307415_100731712 Ga0307415_1007317122 98
97 3300033541 Ga0316596_1122678 Ga0316596_11226782 98
98 3300037471 Ga0395905_0266979 Ga0395905_0266979_88_399 98
99 3300039438 Ga0436360_1061694 Ga0436360_1061694_842_1144 98
100 3300039447 Ga0436361_1073003 Ga0436361_1073003_129_431 98
101 3300041413 Ga0439465_0305251 Ga0439465_0305251_47_349 98
102 3300041505 Ga0451849_0223424 Ga0451849_0223424_78_374 98
103 3300042134 Ga0450898_092145 Ga0450898_092145_44_343 98
104 3300042876 Ga0451577_1705064 Ga0451577_1705064_100_399 98
105 3300044712 Ga0453684_1442363 Ga0453684_1442363_75_374 98
106 3300048908 Ga0496105_1417391 Ga0496105_1417391_62_364 98
107 3300048925 Ga0496122_0047672 Ga0496122_0047672_2530_2826 98
108 3300049520 Ga0501297_036506 Ga0501297_036506_133_429 98
109 3300049527 Ga0501311_011942 Ga0501311_011942_691_990 98
110 3300049536 Ga0501320_041783 Ga0501320_041783_294_593 98
111 3300049537 Ga0501321_021775 Ga0501321_021775_443_742 98
112 3300049537 Ga0501321_029248 Ga0501321_029248_245_592 98
113 3300049592 Ga0501076_1517707 Ga0501076_1517707_192_494 98
114 3300050508 nmdc:mga09592_1716592_c1 nmdc:mga09592_1716592_c1_191_493 98
115 3300059477 Ga0587084_025340 Ga0587084_025340_336_635 98
116 3300059490 Ga0587066_016426 Ga0587066_016426_433_732 98
117 3300059491 Ga0587070_029696 Ga0587070_029696_272_571 98
118 3300059493 Ga0587077_043322 Ga0587077_043322_352_648 98
119 3300059512 Ga0587092_025054 Ga0587092_025054_219_518 98
120 3300059623 Ga0587101_015015 Ga0587101_015015_421_720 98
121 3300059639 Ga0587062_043097 Ga0587062_043097_98_397 98
122 3300059641 Ga0587068_084283 Ga0587068_084283_40_339 98
123 3300059647 Ga0587079_077237 Ga0587079_077237_372_671 98
124 3300059658 Ga0587119_041688 Ga0587119_041688_39_338 98
125 3300004803 Ga0058862_10064717 Ga0058862_100647171 99
126 3300005343 Ga0070687_101541065 Ga0070687_1015410652 99
127 3300005356 Ga0070674_101709637 Ga0070674_1017096371 99
128 3300005456 Ga0070678_100063732 Ga0070678_1000637323 99
129 3300005530 Ga0070679_102125031 Ga0070679_1021250311 99
130 3300005577 Ga0068857_100592130 Ga0068857_1005921302 99
131 3300005614 Ga0068856_100527027 Ga0068856_1005270272 99
132 3300009176 Ga0105242_11475481 Ga0105242_114754811 99
133 3300013296 Ga0157374_10369216 Ga0157374_103692163 99
134 3300013297 Ga0157378_11920241 Ga0157378_119202412 99
135 3300013306 Ga0163162_11316177 Ga0163162_113161772 99
136 3300014745 Ga0157377_11227018 Ga0157377_112270181 99
137 3300025909 Ga0207705_10243074 Ga0207705_102430743 99
138 3300025927 Ga0207687_10642205 Ga0207687_106422052 99
139 3300025934 Ga0207686_10333773 Ga0207686_103337732 99
140 3300025944 Ga0207661_10848581 Ga0207661_108485812 99
141 3300025949 Ga0207667_10589546 Ga0207667_105895463 99
142 3300026078 Ga0207702_10732700 Ga0207702_107327002 99
143 3300026116 Ga0207674_10486922 Ga0207674_104869222 99
144 3300026121 Ga0207683_10049254 Ga0207683_100492544 99
145 3300041460 Ga0451802_0092430 Ga0451802_0092430_129_452 99
146 3300044684 Ga0466966_0676893 Ga0466966_0676893_138_440 99
147 3300059493 Ga0587077_146211 Ga0587077_146211_295_594 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

5

91

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5d-assembly1.cif.gz_BX structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. 0.9579 3 91
6ppf-assembly1.cif.gz_T bacterial 45srbga ribosomal particle class b 0.9343 3 86
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9323 4 89
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.931 1 93
7nhm-assembly1.cif.gz_W 70s ribosome from staphylococcus aureus 0.9301 3 93
ID Description Score Start End Superfamily
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9492 8 91 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.935 3 93 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9251 3 93 3.30.70.330
af_E9AG68_26_145_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9085 4 88 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9074 8 91 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A7V4V1W9-F1-model_v4 Large ribosomal subunit protein uL23 0.9806 1 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G1PGE5-F1-model_v4 Large ribosomal subunit protein uL23 0.9782 2 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A554JB05-F1-model_v4 Large ribosomal subunit protein uL23 0.9778 4 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A833CYL4-F1-model_v4 50S ribosomal protein L23 0.9774 4 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2J0LBU3-F1-model_v4 Large ribosomal subunit protein uL23 0.9765 1 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
90.3 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map