F201501
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 147 | 116 | 147 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300049537|Ga0501321_029248|Ga0501321_029248_245_592 |
| Length | 115 |
| Sequence | MSPEQIIRRPIVLTEKAARLSQQNQVVFEVARDANKIQIRDAVQKLFKVTVTDVNTLVMRGKERRMGRGLAKLQNWKKAIVTLKSGDSIDFFNEVGQPEAASLRKALNDHAAQAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 20 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 21 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 22 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 23 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 24 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 26 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 27 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 28 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 30 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 45 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 59 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 60 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 61 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 62 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 63 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 65 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 66 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 67 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 68 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 70 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 71 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 72 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 73 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 74 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 75 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 76 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 77 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 78 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 79 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 80 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 81 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 82 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 83 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 84 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 85 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 86 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 87 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 88 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 89 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 90 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 91 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 92 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 93 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 98 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 99 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 100 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 101 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.87 |
| Metatranscriptomes | 23.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.04 |
| Rhizosphere | 95.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058862_10064717 | 3300004803 | Bacteria | 587 |
| 2 | Ga0070658_10248441 | 3300005327 | Bacteria | 1509 |
| 3 | Ga0070683_101096120 | 3300005329 | Bacteria | 765 |
| 4 | Ga0070677_10442938 | 3300005333 | Bacteria | 693 |
| 5 | Ga0070689_101594015 | 3300005340 | Bacteria | 593 |
| 6 | Ga0070687_101541065 | 3300005343 | Bacteria | 501 |
| 7 | Ga0070692_10662890 | 3300005345 | Bacteria | 698 |
| 8 | Ga0070669_101662812 | 3300005353 | Bacteria | 556 |
| 9 | Ga0070674_101709637 | 3300005356 | Bacteria | 569 |
| 10 | Ga0070705_101132607 | 3300005440 | Bacteria | 642 |
| 11 | Ga0070694_101544707 | 3300005444 | Bacteria | 562 |
| 12 | Ga0070708_101759426 | 3300005445 | Bacteria | 576 |
| 13 | Ga0070678_100063732 | 3300005456 | Bacteria | 2729 |
| 14 | Ga0068867_101365974 | 3300005459 | Bacteria | 656 |
| 15 | Ga0070707_100076529 | 3300005468 | Bacteria | 3228 |
| 16 | Ga0070679_102125031 | 3300005530 | Bacteria | 511 |
| 17 | Ga0070684_100046281 | 3300005535 | Bacteria | 3769 |
| 18 | Ga0070704_100673329 | 3300005549 | Bacteria | 915 |
| 19 | Ga0070704_101531438 | 3300005549 | Bacteria | 614 |
| 20 | Ga0068857_100592130 | 3300005577 | Bacteria | 1048 |
| 21 | Ga0068856_100527027 | 3300005614 | Bacteria | 1202 |
| 22 | Ga0068859_101078643 | 3300005617 | Bacteria | 883 |
| 23 | Ga0068860_101767836 | 3300005843 | Bacteria | 640 |
| 24 | Ga0068862_102486472 | 3300005844 | Bacteria | 530 |
| 25 | Ga0070715_10368841 | 3300006163 | Bacteria | 789 |
| 26 | Ga0075428_102153828 | 3300006844 | Unclassified | 576 |
| 27 | Ga0075433_11185628 | 3300006852 | Bacteria | 663 |
| 28 | Ga0075429_100651367 | 3300006880 | Bacteria | 923 |
| 29 | Ga0097620_101078476 | 3300006931 | Bacteria | 883 |
| 30 | Ga0075435_101242203 | 3300007076 | Bacteria | 652 |
| 31 | Ga0105240_10737267 | 3300009093 | Bacteria | 1072 |
| 32 | Ga0111539_10638878 | 3300009094 | Bacteria | 1239 |
| 33 | Ga0105245_11589375 | 3300009098 | Bacteria | 705 |
| 34 | Ga0114129_10221820 | 3300009147 | Bacteria | 2550 |
| 35 | Ga0105242_11475481 | 3300009176 | Bacteria | 710 |
| 36 | Ga0105242_12599602 | 3300009176 | Bacteria | 555 |
| 37 | Ga0105238_10020343 | 3300009551 | Bacteria | 6756 |
| 38 | Ga0105238_11136671 | 3300009551 | Bacteria | 804 |
| 39 | Ga0105239_12058136 | 3300010375 | Bacteria | 663 |
| 40 | Ga0157374_10369216 | 3300013296 | Bacteria | 1428 |
| 41 | Ga0157374_10697985 | 3300013296 | Bacteria | 1028 |
| 42 | Ga0157378_11920241 | 3300013297 | Bacteria | 641 |
| 43 | Ga0163162_11316177 | 3300013306 | Bacteria | 821 |
| 44 | Ga0163162_11364259 | 3300013306 | Bacteria | 806 |
| 45 | Ga0163163_11348597 | 3300014325 | Unclassified | 775 |
| 46 | Ga0157380_10379858 | 3300014326 | Bacteria | 1333 |
| 47 | Ga0157377_11227018 | 3300014745 | Bacteria | 582 |
| 48 | Ga0157377_11628013 | 3300014745 | Bacteria | 518 |
| 49 | Ga0157379_11117206 | 3300014968 | Bacteria | 755 |
| 50 | Ga0213876_10662654 | 3300021384 | Bacteria | 555 |
| 51 | Ga0207705_10243074 | 3300025909 | Bacteria | 1371 |
| 52 | Ga0207695_10561581 | 3300025913 | Bacteria | 1023 |
| 53 | Ga0207646_10094365 | 3300025922 | Bacteria | 2679 |
| 54 | Ga0207681_11345085 | 3300025923 | Bacteria | 600 |
| 55 | Ga0207687_10642205 | 3300025927 | Bacteria | 897 |
| 56 | Ga0207686_10333773 | 3300025934 | Bacteria | 1137 |
| 57 | Ga0207686_10782056 | 3300025934 | Bacteria | 764 |
| 58 | Ga0207670_11323173 | 3300025936 | Bacteria | 611 |
| 59 | Ga0207661_10038767 | 3300025944 | Bacteria | 3737 |
| 60 | Ga0207661_10669798 | 3300025944 | Bacteria | 954 |
| 61 | Ga0207661_10848581 | 3300025944 | Bacteria | 841 |
| 62 | Ga0207667_10589546 | 3300025949 | Bacteria | 1122 |
| 63 | Ga0207702_10732700 | 3300026078 | Bacteria | 975 |
| 64 | Ga0207641_11029748 | 3300026088 | Bacteria | 821 |
| 65 | Ga0207674_10486922 | 3300026116 | Bacteria | 1192 |
| 66 | Ga0207683_10049254 | 3300026121 | Bacteria | 3688 |
| 67 | Ga0316576_11034143 | 3300031727 | Unclassified | 584 |
| 68 | Ga0307406_10105490 | 3300031901 | Bacteria | 1928 |
| 69 | Ga0307412_10010183 | 3300031911 | Bacteria | 5410 |
| 70 | Ga0307412_11251834 | 3300031911 | Bacteria | 666 |
| 71 | Ga0307412_11470200 | 3300031911 | Bacteria | 619 |
| 72 | Ga0307409_100271211 | 3300031995 | Bacteria | 1563 |
| 73 | Ga0307415_100731712 | 3300032126 | Bacteria | 896 |
| 74 | Ga0316596_1122678 | 3300033541 | Bacteria | 708 |
| 75 | Ga0373930_0121551 | 3300034816 | Bacteria | 636 |
| 76 | Ga0373941_0521692 | 3300035115 | Bacteria | 508 |
| 77 | Ga0373931_0616180 | 3300035691 | Bacteria | 711 |
| 78 | Ga0373931_0987573 | 3300035691 | Bacteria | 569 |
| 79 | Ga0373937_2066161 | 3300036401 | Bacteria | 516 |
| 80 | Ga0265778_025931 | 3300036457 | Bacteria | 742 |
| 81 | Ga0265778_037124 | 3300036457 | Bacteria | 643 |
| 82 | Ga0395905_0266979 | 3300037471 | Bacteria | 1597 |
| 83 | Ga0395905_0624293 | 3300037471 | Bacteria | 980 |
| 84 | Ga0436365_0296505 | 3300039437 | Bacteria | 1421 |
| 85 | Ga0436360_0347744 | 3300039438 | Bacteria | 946 |
| 86 | Ga0436360_0871162 | 3300039438 | Bacteria | 538 |
| 87 | Ga0436360_1061694 | 3300039438 | Bacteria | 1156 |
| 88 | Ga0436361_0034741 | 3300039447 | Bacteria | 629 |
| 89 | Ga0436361_1073003 | 3300039447 | Bacteria | 586 |
| 90 | Ga0439436_0102393 | 3300041404 | Bacteria | 798 |
| 91 | Ga0439439_0073647 | 3300041406 | Bacteria | 917 |
| 92 | Ga0439465_0081719 | 3300041413 | Bacteria | 1096 |
| 93 | Ga0439465_0305251 | 3300041413 | Bacteria | 596 |
| 94 | Ga0451802_0092430 | 3300041460 | Bacteria | 592 |
| 95 | Ga0451849_0223424 | 3300041505 | Bacteria | 623 |
| 96 | Ga0439445_0021393 | 3300042004 | Bacteria | 1624 |
| 97 | Ga0450898_092145 | 3300042134 | Bacteria | 626 |
| 98 | Ga0439434_0078585 | 3300042435 | Bacteria | 1045 |
| 99 | Ga0451577_1705064 | 3300042876 | Bacteria | 554 |
| 100 | Ga0453683_0112088 | 3300044673 | Bacteria | 1716 |
| 101 | Ga0466966_0676893 | 3300044684 | Bacteria | 622 |
| 102 | Ga0466964_0361965 | 3300044706 | Bacteria | 748 |
| 103 | Ga0453684_0690978 | 3300044712 | Bacteria | 1110 |
| 104 | Ga0453684_1442363 | 3300044712 | Bacteria | 712 |
| 105 | Ga0466970_0526845 | 3300044765 | Bacteria | 682 |
| 106 | Ga0466959_0679361 | 3300045049 | Bacteria | 691 |
| 107 | Ga0451576_0252568 | 3300045051 | Bacteria | 1843 |
| 108 | Ga0496105_1417391 | 3300048908 | Bacteria | 503 |
| 109 | Ga0496113_0744497 | 3300048916 | Unclassified | 781 |
| 110 | Ga0496122_0047672 | 3300048925 | Bacteria | 3306 |
| 111 | Ga0501297_036506 | 3300049520 | Bacteria | 675 |
| 112 | Ga0501311_011942 | 3300049527 | Bacteria | 1077 |
| 113 | Ga0501320_041783 | 3300049536 | Bacteria | 603 |
| 114 | Ga0501321_021775 | 3300049537 | Bacteria | 802 |
| 115 | Ga0501321_029248 | 3300049537 | Bacteria | 728 |
| 116 | Ga0501324_002582 | 3300049540 | Bacteria | 1323 |
| 117 | Ga0501040_0667008 | 3300049576 | Bacteria | 752 |
| 118 | Ga0501047_0096678 | 3300049581 | Bacteria | 2832 |
| 119 | Ga0501076_1517707 | 3300049592 | Bacteria | 550 |
| 120 | nmdc:mga09592_1716592_c1 | 3300050508 | Bacteria | 506 |
| 121 | nmdc:mga09592_598521_c1 | 3300050508 | Bacteria | 945 |
| 122 | Ga0587084_012799 | 3300059477 | Bacteria | 1142 |
| 123 | Ga0587084_025340 | 3300059477 | Bacteria | 919 |
| 124 | Ga0587093_012944 | 3300059478 | Bacteria | 1020 |
| 125 | Ga0587066_016426 | 3300059490 | Bacteria | 1166 |
| 126 | Ga0587070_029696 | 3300059491 | Bacteria | 983 |
| 127 | Ga0587077_019586 | 3300059493 | Bacteria | 1180 |
| 128 | Ga0587077_021660 | 3300059493 | Bacteria | 1143 |
| 129 | Ga0587077_043322 | 3300059493 | Bacteria | 912 |
| 130 | Ga0587077_146211 | 3300059493 | Bacteria | 613 |
| 131 | Ga0587077_151195 | 3300059493 | Bacteria | 607 |
| 132 | Ga0587085_013393 | 3300059506 | Bacteria | 1141 |
| 133 | Ga0587085_015178 | 3300059506 | Bacteria | 1097 |
| 134 | Ga0587092_025054 | 3300059512 | Bacteria | 951 |
| 135 | Ga0587101_015015 | 3300059623 | Bacteria | 1042 |
| 136 | Ga0587101_041419 | 3300059623 | Bacteria | 761 |
| 137 | Ga0587109_019596 | 3300059624 | Bacteria | 1194 |
| 138 | Ga0587109_026128 | 3300059624 | Bacteria | 1078 |
| 139 | Ga0587109_079803 | 3300059624 | Bacteria | 722 |
| 140 | Ga0587062_043097 | 3300059639 | Bacteria | 739 |
| 141 | Ga0587062_080398 | 3300059639 | Bacteria | 605 |
| 142 | Ga0587068_084283 | 3300059641 | Bacteria | 646 |
| 143 | Ga0587076_011383 | 3300059645 | Bacteria | 1306 |
| 144 | Ga0587079_077237 | 3300059647 | Bacteria | 755 |
| 145 | Ga0587119_041688 | 3300059658 | Bacteria | 660 |
| 146 | Ga0587124_002165 | 3300059660 | Bacteria | 1358 |
| 147 | Ga0466962_0546339 | 3300061719 | Bacteria | 588 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300061719 | Ga0466962_0546339 | Ga0466962_0546339_204_500 | 83 |
| 2 | 3300039438 | Ga0436360_0347744 | Ga0436360_0347744_651_914 | 86 |
| 3 | 3300009147 | Ga0114129_10221820 | Ga0114129_102218202 | 94 |
| 4 | 3300009551 | Ga0105238_10020343 | Ga0105238_100203434 | 94 |
| 5 | 3300031911 | Ga0307412_11251834 | Ga0307412_112518342 | 94 |
| 6 | 3300050508 | nmdc:mga09592_598521_c1 | nmdc:mga09592_598521_c1_260_592 | 94 |
| 7 | 3300005327 | Ga0070658_10248441 | Ga0070658_102484412 | 97 |
| 8 | 3300005329 | Ga0070683_101096120 | Ga0070683_1010961202 | 97 |
| 9 | 3300005340 | Ga0070689_101594015 | Ga0070689_1015940151 | 97 |
| 10 | 3300005440 | Ga0070705_101132607 | Ga0070705_1011326072 | 97 |
| 11 | 3300005444 | Ga0070694_101544707 | Ga0070694_1015447072 | 97 |
| 12 | 3300005459 | Ga0068867_101365974 | Ga0068867_1013659742 | 97 |
| 13 | 3300005468 | Ga0070707_100076529 | Ga0070707_1000765295 | 97 |
| 14 | 3300005549 | Ga0070704_101531438 | Ga0070704_1015314381 | 97 |
| 15 | 3300005617 | Ga0068859_101078643 | Ga0068859_1010786432 | 97 |
| 16 | 3300006163 | Ga0070715_10368841 | Ga0070715_103688412 | 97 |
| 17 | 3300006844 | Ga0075428_102153828 | Ga0075428_1021538282 | 97 |
| 18 | 3300006852 | Ga0075433_11185628 | Ga0075433_111856282 | 97 |
| 19 | 3300006880 | Ga0075429_100651367 | Ga0075429_1006513672 | 97 |
| 20 | 3300006931 | Ga0097620_101078476 | Ga0097620_1010784762 | 97 |
| 21 | 3300010375 | Ga0105239_12058136 | Ga0105239_120581362 | 97 |
| 22 | 3300013306 | Ga0163162_11364259 | Ga0163162_113642592 | 97 |
| 23 | 3300014745 | Ga0157377_11628013 | Ga0157377_116280131 | 97 |
| 24 | 3300014968 | Ga0157379_11117206 | Ga0157379_111172062 | 97 |
| 25 | 3300021384 | Ga0213876_10662654 | Ga0213876_106626542 | 97 |
| 26 | 3300025913 | Ga0207695_10561581 | Ga0207695_105615812 | 97 |
| 27 | 3300025922 | Ga0207646_10094365 | Ga0207646_100943652 | 97 |
| 28 | 3300025936 | Ga0207670_11323173 | Ga0207670_113231732 | 97 |
| 29 | 3300025944 | Ga0207661_10669798 | Ga0207661_106697982 | 97 |
| 30 | 3300026088 | Ga0207641_11029748 | Ga0207641_110297482 | 97 |
| 31 | 3300034816 | Ga0373930_0121551 | Ga0373930_0121551_319_615 | 97 |
| 32 | 3300035115 | Ga0373941_0521692 | Ga0373941_0521692_46_342 | 97 |
| 33 | 3300035691 | Ga0373931_0616180 | Ga0373931_0616180_354_650 | 97 |
| 34 | 3300035691 | Ga0373931_0987573 | Ga0373931_0987573_188_484 | 97 |
| 35 | 3300036401 | Ga0373937_2066161 | Ga0373937_2066161_114_407 | 97 |
| 36 | 3300036457 | Ga0265778_025931 | Ga0265778_025931_125_421 | 97 |
| 37 | 3300036457 | Ga0265778_037124 | Ga0265778_037124_219_515 | 97 |
| 38 | 3300037471 | Ga0395905_0624293 | Ga0395905_0624293_184_480 | 97 |
| 39 | 3300039437 | Ga0436365_0296505 | Ga0436365_0296505_476_769 | 97 |
| 40 | 3300039438 | Ga0436360_0871162 | Ga0436360_0871162_157_453 | 97 |
| 41 | 3300039447 | Ga0436361_0034741 | Ga0436361_0034741_236_532 | 97 |
| 42 | 3300041404 | Ga0439436_0102393 | Ga0439436_0102393_399_695 | 97 |
| 43 | 3300041406 | Ga0439439_0073647 | Ga0439439_0073647_227_523 | 97 |
| 44 | 3300041413 | Ga0439465_0081719 | Ga0439465_0081719_371_667 | 97 |
| 45 | 3300042004 | Ga0439445_0021393 | Ga0439445_0021393_1196_1492 | 97 |
| 46 | 3300042435 | Ga0439434_0078585 | Ga0439434_0078585_572_868 | 97 |
| 47 | 3300044673 | Ga0453683_0112088 | Ga0453683_0112088_1231_1524 | 97 |
| 48 | 3300044706 | Ga0466964_0361965 | Ga0466964_0361965_153_449 | 97 |
| 49 | 3300044712 | Ga0453684_0690978 | Ga0453684_0690978_442_738 | 97 |
| 50 | 3300044765 | Ga0466970_0526845 | Ga0466970_0526845_126_422 | 97 |
| 51 | 3300045049 | Ga0466959_0679361 | Ga0466959_0679361_95_391 | 97 |
| 52 | 3300045051 | Ga0451576_0252568 | Ga0451576_0252568_405_701 | 97 |
| 53 | 3300048916 | Ga0496113_0744497 | Ga0496113_0744497_441_734 | 97 |
| 54 | 3300049540 | Ga0501324_002582 | Ga0501324_002582_282_578 | 97 |
| 55 | 3300049576 | Ga0501040_0667008 | Ga0501040_0667008_278_574 | 97 |
| 56 | 3300049581 | Ga0501047_0096678 | Ga0501047_0096678_1200_1496 | 97 |
| 57 | 3300059477 | Ga0587084_012799 | Ga0587084_012799_519_815 | 97 |
| 58 | 3300059478 | Ga0587093_012944 | Ga0587093_012944_320_616 | 97 |
| 59 | 3300059493 | Ga0587077_019586 | Ga0587077_019586_528_821 | 97 |
| 60 | 3300059493 | Ga0587077_021660 | Ga0587077_021660_439_735 | 97 |
| 61 | 3300059493 | Ga0587077_151195 | Ga0587077_151195_250_546 | 97 |
| 62 | 3300059506 | Ga0587085_013393 | Ga0587085_013393_437_733 | 97 |
| 63 | 3300059506 | Ga0587085_015178 | Ga0587085_015178_353_649 | 97 |
| 64 | 3300059623 | Ga0587101_041419 | Ga0587101_041419_249_545 | 97 |
| 65 | 3300059624 | Ga0587109_019596 | Ga0587109_019596_518_811 | 97 |
| 66 | 3300059624 | Ga0587109_026128 | Ga0587109_026128_646_942 | 97 |
| 67 | 3300059624 | Ga0587109_079803 | Ga0587109_079803_27_323 | 97 |
| 68 | 3300059639 | Ga0587062_080398 | Ga0587062_080398_269_565 | 97 |
| 69 | 3300059645 | Ga0587076_011383 | Ga0587076_011383_363_659 | 97 |
| 70 | 3300059660 | Ga0587124_002165 | Ga0587124_002165_606_902 | 97 |
| 71 | 3300005333 | Ga0070677_10442938 | Ga0070677_104429382 | 98 |
| 72 | 3300005345 | Ga0070692_10662890 | Ga0070692_106628902 | 98 |
| 73 | 3300005353 | Ga0070669_101662812 | Ga0070669_1016628122 | 98 |
| 74 | 3300005445 | Ga0070708_101759426 | Ga0070708_1017594262 | 98 |
| 75 | 3300005535 | Ga0070684_100046281 | Ga0070684_1000462813 | 98 |
| 76 | 3300005549 | Ga0070704_100673329 | Ga0070704_1006733292 | 98 |
| 77 | 3300005843 | Ga0068860_101767836 | Ga0068860_1017678362 | 98 |
| 78 | 3300005844 | Ga0068862_102486472 | Ga0068862_1024864722 | 98 |
| 79 | 3300007076 | Ga0075435_101242203 | Ga0075435_1012422032 | 98 |
| 80 | 3300009093 | Ga0105240_10737267 | Ga0105240_107372672 | 98 |
| 81 | 3300009094 | Ga0111539_10638878 | Ga0111539_106388783 | 98 |
| 82 | 3300009098 | Ga0105245_11589375 | Ga0105245_115893752 | 98 |
| 83 | 3300009176 | Ga0105242_12599602 | Ga0105242_125996022 | 98 |
| 84 | 3300009551 | Ga0105238_11136671 | Ga0105238_111366712 | 98 |
| 85 | 3300013296 | Ga0157374_10697985 | Ga0157374_106979852 | 98 |
| 86 | 3300014325 | Ga0163163_11348597 | Ga0163163_113485972 | 98 |
| 87 | 3300014326 | Ga0157380_10379858 | Ga0157380_103798582 | 98 |
| 88 | 3300025923 | Ga0207681_11345085 | Ga0207681_113450851 | 98 |
| 89 | 3300025934 | Ga0207686_10782056 | Ga0207686_107820562 | 98 |
| 90 | 3300025944 | Ga0207661_10038767 | Ga0207661_100387677 | 98 |
| 91 | 3300031727 | Ga0316576_11034143 | Ga0316576_110341431 | 98 |
| 92 | 3300031901 | Ga0307406_10105490 | Ga0307406_101054902 | 98 |
| 93 | 3300031911 | Ga0307412_10010183 | Ga0307412_100101834 | 98 |
| 94 | 3300031911 | Ga0307412_11470200 | Ga0307412_114702002 | 98 |
| 95 | 3300031995 | Ga0307409_100271211 | Ga0307409_1002712112 | 98 |
| 96 | 3300032126 | Ga0307415_100731712 | Ga0307415_1007317122 | 98 |
| 97 | 3300033541 | Ga0316596_1122678 | Ga0316596_11226782 | 98 |
| 98 | 3300037471 | Ga0395905_0266979 | Ga0395905_0266979_88_399 | 98 |
| 99 | 3300039438 | Ga0436360_1061694 | Ga0436360_1061694_842_1144 | 98 |
| 100 | 3300039447 | Ga0436361_1073003 | Ga0436361_1073003_129_431 | 98 |
| 101 | 3300041413 | Ga0439465_0305251 | Ga0439465_0305251_47_349 | 98 |
| 102 | 3300041505 | Ga0451849_0223424 | Ga0451849_0223424_78_374 | 98 |
| 103 | 3300042134 | Ga0450898_092145 | Ga0450898_092145_44_343 | 98 |
| 104 | 3300042876 | Ga0451577_1705064 | Ga0451577_1705064_100_399 | 98 |
| 105 | 3300044712 | Ga0453684_1442363 | Ga0453684_1442363_75_374 | 98 |
| 106 | 3300048908 | Ga0496105_1417391 | Ga0496105_1417391_62_364 | 98 |
| 107 | 3300048925 | Ga0496122_0047672 | Ga0496122_0047672_2530_2826 | 98 |
| 108 | 3300049520 | Ga0501297_036506 | Ga0501297_036506_133_429 | 98 |
| 109 | 3300049527 | Ga0501311_011942 | Ga0501311_011942_691_990 | 98 |
| 110 | 3300049536 | Ga0501320_041783 | Ga0501320_041783_294_593 | 98 |
| 111 | 3300049537 | Ga0501321_021775 | Ga0501321_021775_443_742 | 98 |
| 112 | 3300049537 | Ga0501321_029248 | Ga0501321_029248_245_592 | 98 |
| 113 | 3300049592 | Ga0501076_1517707 | Ga0501076_1517707_192_494 | 98 |
| 114 | 3300050508 | nmdc:mga09592_1716592_c1 | nmdc:mga09592_1716592_c1_191_493 | 98 |
| 115 | 3300059477 | Ga0587084_025340 | Ga0587084_025340_336_635 | 98 |
| 116 | 3300059490 | Ga0587066_016426 | Ga0587066_016426_433_732 | 98 |
| 117 | 3300059491 | Ga0587070_029696 | Ga0587070_029696_272_571 | 98 |
| 118 | 3300059493 | Ga0587077_043322 | Ga0587077_043322_352_648 | 98 |
| 119 | 3300059512 | Ga0587092_025054 | Ga0587092_025054_219_518 | 98 |
| 120 | 3300059623 | Ga0587101_015015 | Ga0587101_015015_421_720 | 98 |
| 121 | 3300059639 | Ga0587062_043097 | Ga0587062_043097_98_397 | 98 |
| 122 | 3300059641 | Ga0587068_084283 | Ga0587068_084283_40_339 | 98 |
| 123 | 3300059647 | Ga0587079_077237 | Ga0587079_077237_372_671 | 98 |
| 124 | 3300059658 | Ga0587119_041688 | Ga0587119_041688_39_338 | 98 |
| 125 | 3300004803 | Ga0058862_10064717 | Ga0058862_100647171 | 99 |
| 126 | 3300005343 | Ga0070687_101541065 | Ga0070687_1015410652 | 99 |
| 127 | 3300005356 | Ga0070674_101709637 | Ga0070674_1017096371 | 99 |
| 128 | 3300005456 | Ga0070678_100063732 | Ga0070678_1000637323 | 99 |
| 129 | 3300005530 | Ga0070679_102125031 | Ga0070679_1021250311 | 99 |
| 130 | 3300005577 | Ga0068857_100592130 | Ga0068857_1005921302 | 99 |
| 131 | 3300005614 | Ga0068856_100527027 | Ga0068856_1005270272 | 99 |
| 132 | 3300009176 | Ga0105242_11475481 | Ga0105242_114754811 | 99 |
| 133 | 3300013296 | Ga0157374_10369216 | Ga0157374_103692163 | 99 |
| 134 | 3300013297 | Ga0157378_11920241 | Ga0157378_119202412 | 99 |
| 135 | 3300013306 | Ga0163162_11316177 | Ga0163162_113161772 | 99 |
| 136 | 3300014745 | Ga0157377_11227018 | Ga0157377_112270181 | 99 |
| 137 | 3300025909 | Ga0207705_10243074 | Ga0207705_102430743 | 99 |
| 138 | 3300025927 | Ga0207687_10642205 | Ga0207687_106422052 | 99 |
| 139 | 3300025934 | Ga0207686_10333773 | Ga0207686_103337732 | 99 |
| 140 | 3300025944 | Ga0207661_10848581 | Ga0207661_108485812 | 99 |
| 141 | 3300025949 | Ga0207667_10589546 | Ga0207667_105895463 | 99 |
| 142 | 3300026078 | Ga0207702_10732700 | Ga0207702_107327002 | 99 |
| 143 | 3300026116 | Ga0207674_10486922 | Ga0207674_104869222 | 99 |
| 144 | 3300026121 | Ga0207683_10049254 | Ga0207683_100492544 | 99 |
| 145 | 3300041460 | Ga0451802_0092430 | Ga0451802_0092430_129_452 | 99 |
| 146 | 3300044684 | Ga0466966_0676893 | Ga0466966_0676893_138_440 | 99 |
| 147 | 3300059493 | Ga0587077_146211 | Ga0587077_146211_295_594 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v5d-assembly1.cif.gz_BX | structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. | 0.9579 | 3 | 91 |
| 6ppf-assembly1.cif.gz_T | bacterial 45srbga ribosomal particle class b | 0.9343 | 3 | 86 |
| 7m4z-assembly1.cif.gz_S | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.9323 | 4 | 89 |
| 8cvm-assembly1.cif.gz_s | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.931 | 1 | 93 |
| 7nhm-assembly1.cif.gz_W | 70s ribosome from staphylococcus aureus | 0.9301 | 3 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9492 | 8 | 91 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.935 | 3 | 93 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9251 | 3 | 93 | 3.30.70.330 |
| af_E9AG68_26_145_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9085 | 4 | 88 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9074 | 8 | 91 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V4V1W9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9806 | 1 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G1PGE5-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9782 | 2 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A554JB05-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9778 | 4 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A833CYL4-F1-model_v4 | 50S ribosomal protein L23 | 0.9774 | 4 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2J0LBU3-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9765 | 1 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar