F201446

General Info

Members Datasets Scaffolds Average Seq Length
147 116 294 437

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0122169|Ga0496108_0122169_49_1602
Length 486
Sequence MGGQEGADLRAEGGEFWGFGQVHGRTPGPHGDEVSRASATAPWRQLATDAAKLCLYRHRRPSMTRQTLFSASALAALXXAACTMTPGSSDPFVGFGPNPPMAKAQSSLLPVVGVPDVVGWPAGAAPKAPAGFVVTRFAEGLDHPRWLYVLPNGDVLVAESASVPSPADKSNQGIKGYFQKLLMKRVGSAKPSPNKILLLRDVDGDGVAETKTLFAQGLTRPFGMTLVGDTLYVANDDGVVSFPYAAGQTSEQGVGTKVFDLPGPPINHHWTKNVVASPDGSKLYATVGSNSNVGDNGMENEVGRAAIWEYDIATAKPRVFASGIRNPNGIGFEPTTGVMWTVSNERDEIGNDMPSDYLTSVRDGGFYGWPYSYYGQNVDTRVKPPRPDLVAKAIAPDYGLGPHTAHGSWNRNPLNGYRVVFIPFAGGRPQMPPQMFLSGFLNAKDKIQGRPVGVVVDKRGALLVADDVGNIVWRVAPAARAASTAN

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
106 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
107 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
108 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
109 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
110 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
111 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
112 2902330777 Methylobacterium sp. 2A Isolate Unclassified
113 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
114 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
115 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
116 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 0
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.93
Nodule 4.08
Rhizoplane 3.4
Rhizosphere 70.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0122169 3300048911 Bacteria 2234
2 JGI24735J21928_10020494 3300002067 Bacteria 2024
3 JGI25160J50197_1000152 3300003354 Bacteria 60894
4 Ga0055530_10000902 3300003791 Bacteria 24454
5 Ga0055531_10000770 3300003794 Bacteria 26750
6 Ga0055531_10036664 3300003794 Bacteria 1507
7 Ga0065165_1000432 3300005262 Bacteria 65916
8 Ga0065165_1002146 3300005262 Bacteria 17879
9 Ga0070658_10019401 3300005327 Bacteria 5446
10 Ga0070658_10179752 3300005327 Bacteria 1780
11 Ga0070683_100109276 3300005329 Bacteria 2608
12 Ga0070680_100052147 3300005336 Bacteria 3339
13 Ga0070661_100014447 3300005344 Bacteria 5565
14 Ga0070668_100022557 3300005347 Bacteria 4760
15 Ga0070659_100115771 3300005366 Bacteria 2167
16 Ga0070714_100106939 3300005435 Bacteria 2472
17 Ga0070678_100003582 3300005456 Bacteria 8669
18 Ga0070707_100062515 3300005468 Bacteria 3572
19 Ga0070665_100016026 3300005548 Bacteria 7523
20 Ga0068855_100043269 3300005563 Bacteria 5335
21 Ga0068855_100056037 3300005563 Bacteria 4626
22 Ga0068855_100144725 3300005563 Bacteria 2707
23 Ga0070664_100076173 3300005564 Bacteria 2882
24 Ga0070664_100110242 3300005564 Bacteria 2401
25 Ga0068852_100072159 3300005616 Bacteria 3034
26 Ga0068864_100001553 3300005618 Bacteria 18909
27 Ga0068866_10036280 3300005718 Bacteria 2414
28 Ga0068863_100000316 3300005841 Bacteria 49065
29 Ga0068858_100000224 3300005842 Bacteria 61485
30 Ga0068860_100000051 3300005843 Bacteria 208179
31 Ga0068862_100131969 3300005844 Bacteria 2210
32 Ga0081455_10000197 3300005937 Bacteria 76374
33 Ga0081455_10007709 3300005937 Bacteria 11292
34 Ga0081455_10021564 3300005937 Bacteria 6039
35 Ga0081540_1001709 3300005983 Bacteria 18581
36 Ga0081540_1031199 3300005983 Bacteria 2935
37 Ga0081539_10007671 3300005985 Bacteria 9703
38 Ga0070717_10001164 3300006028 Bacteria 17767
39 Ga0075364_10099767 3300006051 Bacteria 1933
40 Ga0070716_100030763 3300006173 Bacteria 2916
41 Ga0099795_10013940 3300007788 Bacteria 2480
42 Ga0099795_10030745 3300007788 Bacteria 1845
43 Ga0105250_10007762 3300009092 Bacteria 4596
44 Ga0105240_10012568 3300009093 Bacteria 11680
45 Ga0105240_10086053 3300009093 Bacteria 3850
46 Ga0105248_10135218 3300009177 Bacteria 2781
47 Ga0105237_10070317 3300009545 Bacteria 3496
48 Ga0105238_10003309 3300009551 Bacteria 16095
49 Ga0105238_10005350 3300009551 Bacteria 12681
50 Ga0157370_10075974 3300013104 Bacteria 3165
51 Ga0157370_10087117 3300013104 Bacteria 2933
52 Ga0157370_10141064 3300013104 Bacteria 2245
53 Ga0163162_10086167 3300013306 Bacteria 3219
54 Ga0157372_10322822 3300013307 Bacteria 1798
55 Ga0157375_10106713 3300013308 Bacteria 2893
56 Ga0163163_10062685 3300014325 Bacteria 3685
57 Ga0209026_1000575 3300025250 Bacteria 24329
58 Ga0209148_1002284 3300025254 Bacteria 6905
59 Ga0209455_1000653 3300025272 Bacteria 21187
60 Ga0209130_1003495 3300025284 Bacteria 6603
61 Ga0209758_1001237 3300025297 Bacteria 31904
62 Ga0209758_1006457 3300025297 Bacteria 8410
63 Ga0209050_1000274 3300025298 Bacteria 110441
64 Ga0207426_1000103 3300025302 Bacteria 250320
65 Ga0209257_1000294 3300025304 Bacteria 110164
66 Ga0209257_1001734 3300025304 Bacteria 24258
67 Ga0207647_10120761 3300025904 Bacteria 1545
68 Ga0207705_10006566 3300025909 Bacteria 8617
69 Ga0207693_10040517 3300025915 Bacteria 3669
70 Ga0207657_10015661 3300025919 Bacteria 7334
71 Ga0207694_10022583 3300025924 Bacteria 4773
72 Ga0207694_10031858 3300025924 Bacteria 4030
73 Ga0207644_10038430 3300025931 Bacteria 3371
74 Ga0207690_10119223 3300025932 Bacteria 1914
75 Ga0207665_10011711 3300025939 Bacteria 5763
76 Ga0207711_10079010 3300025941 Bacteria 2871
77 Ga0207661_10013144 3300025944 Bacteria 6042
78 Ga0207679_10021864 3300025945 Bacteria 4345
79 Ga0207667_10037376 3300025949 Bacteria 5190
80 Ga0207667_10062052 3300025949 Bacteria 3910
81 Ga0207668_10003503 3300025972 Bacteria 9215
82 Ga0207668_10098294 3300025972 Bacteria 2168
83 Ga0207703_10000245 3300026035 Bacteria 61514
84 Ga0207678_10043609 3300026067 Bacteria 3881
85 Ga0207702_10023349 3300026078 Bacteria 5128
86 Ga0207641_10000134 3300026088 Bacteria 109053
87 Ga0207676_10000712 3300026095 Bacteria 26130
88 Ga0207676_10000926 3300026095 Bacteria 22708
89 Ga0207698_10041694 3300026142 Bacteria 3423
90 Ga0209179_1000600 3300027512 Bacteria 3798
91 Ga0268266_10228494 3300028379 Bacteria 1713
92 Ga0268265_10093972 3300028380 Bacteria 2404
93 Ga0268264_10000021 3300028381 Bacteria 481580
94 Ga0307517_10025135 3300028786 Bacteria 7301
95 Ga0307515_10121800 3300028794 Bacteria 2948
96 Ga0307511_10011448 3300030521 Bacteria 8741
97 Ga0265331_10056086 3300031250 Bacteria 1872
98 Ga0265327_10001355 3300031251 Bacteria 31646
99 Ga0307513_10000276 3300031456 Bacteria 74546
100 Ga0307513_10000588 3300031456 Bacteria 52189
101 Ga0307513_10046721 3300031456 Bacteria 4716
102 Ga0373935_0034454 3300035692 Bacteria 3156
103 Ga0373927_0004160 3300035695 Bacteria 10170
104 Ga0373927_0102397 3300035695 Bacteria 1863
105 Ga0373925_0001114 3300037068 Bacteria 23886
106 Ga0395899_0001503 3300037312 Bacteria 19803
107 Ga0395899_0056974 3300037312 Bacteria 2886
108 Ga0395898_0004506 3300037466 Bacteria 15228
109 Ga0395898_0066570 3300037466 Bacteria 3489
110 Ga0395905_0051268 3300037471 Bacteria 3865
111 Ga0436364_0629883 3300037853 Bacteria 3187
112 Ga0395901_0002101 3300038443 Bacteria 20455
113 Ga0395901_0037384 3300038443 Bacteria 5021
114 Ga0395901_0169285 3300038443 Bacteria 2292
115 Ga0395901_0175674 3300038443 Bacteria 2247
116 Ga0466970_0071221 3300044765 Bacteria 1870
117 Ga0466967_0121291 3300045976 Bacteria 2416
118 Ga0495648_0042020 3300046524 Bacteria 2880
119 Ga0495670_0035092 3300046691 Bacteria 2499
120 Ga0495672_0004321 3300047320 Bacteria 11702
121 Ga0495672_0017702 3300047320 Bacteria 4758
122 Ga0496102_0013658 3300048905 Bacteria 7038
123 Ga0496109_0013674 3300048912 Bacteria 7049
124 Ga0496115_0051648 3300048918 Bacteria 3296
125 Ga0496115_0261747 3300048918 Bacteria 1422
126 Ga0496118_0008824 3300048921 Bacteria 10324
127 Ga0496119_0113651 3300048922 Bacteria 1499
128 Ga0496121_0016531 3300048924 Bacteria 7611
129 Ga0496122_0007257 3300048925 Bacteria 12397
130 Ga0496123_0012784 3300048926 Bacteria 7119
131 Ga0501047_0016189 3300049581 Bacteria 7115
132 Ga0501047_0131858 3300049581 Bacteria 2379
133 Ga0501048_0061272 3300049582 Bacteria 2665
134 Ga0501035_0068971 3300049822 Bacteria 3135
135 Ga0501044_0002987 3300049823 Bacteria 19164
136 Ga0495655_0011555 3300053083 Bacteria 1777
137 Ga0500641_0013526 3300053096 Bacteria 2999
138 Ga0500562_000465 3300053108 Bacteria 9816
139 Ga0500645_002937 3300053730 Bacteria 7253
140 2509148426 2508501128 Bacteria 8613869
141 2513642444 2513237094 Bacteria 8789602
142 2889311160 2889306138 Bacteria 6358934
143 2902336134 2902330777 Bacteria 6395352
144 2935636363 2935630451 Bacteria 8169952
145 2941512994 2941507105 Bacteria 8166816
146 2941520704 2941515067 Bacteria 8166720
147 2941528719 2941523033 Bacteria 8169134
148 Ga0496108_0122169
149 JGI24735J21928_10020494
150 JGI25160J50197_1000152
151 Ga0055530_10000902
152 Ga0055531_10000770
153 Ga0055531_10036664
154 Ga0065165_1000432
155 Ga0065165_1002146
156 Ga0070658_10019401
157 Ga0070658_10179752
158 Ga0070683_100109276
159 Ga0070680_100052147
160 Ga0070661_100014447
161 Ga0070668_100022557
162 Ga0070659_100115771
163 Ga0070714_100106939
164 Ga0070678_100003582
165 Ga0070707_100062515
166 Ga0070665_100016026
167 Ga0068855_100043269
168 Ga0068855_100056037
169 Ga0068855_100144725
170 Ga0070664_100076173
171 Ga0070664_100110242
172 Ga0068852_100072159
173 Ga0068864_100001553
174 Ga0068866_10036280
175 Ga0068863_100000316
176 Ga0068858_100000224
177 Ga0068860_100000051
178 Ga0068862_100131969
179 Ga0081455_10000197
180 Ga0081455_10007709
181 Ga0081455_10021564
182 Ga0081540_1001709
183 Ga0081540_1031199
184 Ga0081539_10007671
185 Ga0070717_10001164
186 Ga0075364_10099767
187 Ga0070716_100030763
188 Ga0099795_10013940
189 Ga0099795_10030745
190 Ga0105250_10007762
191 Ga0105240_10012568
192 Ga0105240_10086053
193 Ga0105248_10135218
194 Ga0105237_10070317
195 Ga0105238_10003309
196 Ga0105238_10005350
197 Ga0157370_10075974
198 Ga0157370_10087117
199 Ga0157370_10141064
200 Ga0163162_10086167
201 Ga0157372_10322822
202 Ga0157375_10106713
203 Ga0163163_10062685
204 Ga0209026_1000575
205 Ga0209148_1002284
206 Ga0209455_1000653
207 Ga0209130_1003495
208 Ga0209758_1001237
209 Ga0209758_1006457
210 Ga0209050_1000274
211 Ga0207426_1000103
212 Ga0209257_1000294
213 Ga0209257_1001734
214 Ga0207647_10120761
215 Ga0207705_10006566
216 Ga0207693_10040517
217 Ga0207657_10015661
218 Ga0207694_10022583
219 Ga0207694_10031858
220 Ga0207644_10038430
221 Ga0207690_10119223
222 Ga0207665_10011711
223 Ga0207711_10079010
224 Ga0207661_10013144
225 Ga0207679_10021864
226 Ga0207667_10037376
227 Ga0207667_10062052
228 Ga0207668_10003503
229 Ga0207668_10098294
230 Ga0207703_10000245
231 Ga0207678_10043609
232 Ga0207702_10023349
233 Ga0207641_10000134
234 Ga0207676_10000712
235 Ga0207676_10000926
236 Ga0207698_10041694
237 Ga0209179_1000600
238 Ga0268266_10228494
239 Ga0268265_10093972
240 Ga0268264_10000021
241 Ga0307517_10025135
242 Ga0307515_10121800
243 Ga0307511_10011448
244 Ga0265331_10056086
245 Ga0265327_10001355
246 Ga0307513_10000276
247 Ga0307513_10000588
248 Ga0307513_10046721
249 Ga0373935_0034454
250 Ga0373927_0004160
251 Ga0373927_0102397
252 Ga0373925_0001114
253 Ga0395899_0001503
254 Ga0395899_0056974
255 Ga0395898_0004506
256 Ga0395898_0066570
257 Ga0395905_0051268
258 Ga0436364_0629883
259 Ga0395901_0002101
260 Ga0395901_0037384
261 Ga0395901_0169285
262 Ga0395901_0175674
263 Ga0466970_0071221
264 Ga0466967_0121291
265 Ga0495648_0042020
266 Ga0495670_0035092
267 Ga0495672_0004321
268 Ga0495672_0017702
269 Ga0496102_0013658
270 Ga0496109_0013674
271 Ga0496115_0051648
272 Ga0496115_0261747
273 Ga0496118_0008824
274 Ga0496119_0113651
275 Ga0496121_0016531
276 Ga0496122_0007257
277 Ga0496123_0012784
278 Ga0501047_0016189
279 Ga0501047_0131858
280 Ga0501048_0061272
281 Ga0501035_0068971
282 Ga0501044_0002987
283 Ga0495655_0011555
284 Ga0500641_0013526
285 Ga0500562_000465
286 Ga0500645_002937
287 2509148426
288 2513642444
289 2889311160
290 2902336134
291 2935636363
292 2941512994
293 2941520704
294 2941528719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

256

407

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jwf-assembly1.cif.gz_A holo form of pyranose dehydrogenase pqq domain from coprinopsis cinerea 0.7673 61 430
6i1t-assembly1.cif.gz_A calcium structure of trichoderma reesei carbohydrate-active enzymes family aa12 0.7514 62 431
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7485 67 431
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.7375 69 431
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7361 67 431
ID Description Score Start End Superfamily
af_Q9VXM0_1525_1835_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7617 128 432 2.120.10.30
af_Q91VN0_28_290_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7492 126 431 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7422 67 431 2.120.10.30
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7342 63 431 2.120.10.30
af_I6Y293_69_358_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7341 73 419 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A522QYE5-F1-model_v4 Sorbosone dehydrogenase family protein 0.9688 324 428
AF-A0A136QLG4-F1-model_v4 deleted 0.9652 216 428
AF-A0A2R7SZ97-F1-model_v4 deleted 0.9649 148 428
AF-A9EF37-F1-model_v4 deleted 0.964 127 428
AF-A0A836ZSE0-F1-model_v4 Sorbosone dehydrogenase 0.9633 347 430

Map