F201188

General Info

Members Datasets Scaffolds Average Seq Length
147 122 144 171

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0146792|Ga0451576_0146792_1643_2257
Length 204
Sequence MTDAVYNVLFLCTGNSARSILAECILNREGQGRFKAFSAGSQPKGQVHPFALALLKKMNHPTAGLRSKSWDEFAAPGAPRLNFVFTVCDNAASEVCPAWPGQPMTAHWGVPDPAAAEGTEAERHLAFAESYRMLHNRISIFTSLPLSSIDRLSLQKRLDEIGQSMPRPMPRTGLSQCRRSISIGAPSPSSSARGCWWPPSSVRA

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 3004167301 Mesorhizobium loti 582 Isolate Unclassified
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
40 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
58 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
66 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
85 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
115 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
116 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
119 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
122 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0
Rhizoplane 0.68
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000003 3300003214 Bacteria 694080
2 Ga0055540_1062021 3300003792 Bacteria 745
3 Ga0055531_10002352 3300003794 Bacteria 12725
4 Ga0070658_10564500 3300005327 Bacteria 985
5 Ga0070682_100159827 3300005337 Bacteria 1555
6 Ga0070689_100119824 3300005340 Bacteria 2101
7 Ga0070669_100082849 3300005353 Bacteria 2392
8 Ga0070669_100518972 3300005353 Bacteria 990
9 Ga0070674_100058063 3300005356 Bacteria 2688
10 Ga0070659_100023335 3300005366 Bacteria 4733
11 Ga0070713_100180899 3300005436 Bacteria 1894
12 Ga0070705_100428993 3300005440 Bacteria 986
13 Ga0070679_100043279 3300005530 Bacteria 4485
14 Ga0068853_100000281 3300005539 Bacteria 35996
15 Ga0070696_100013012 3300005546 Bacteria 5582
16 Ga0070665_100348614 3300005548 Bacteria 1486
17 Ga0068855_100220350 3300005563 Bacteria 2128
18 Ga0068857_100004703 3300005577 Bacteria 11572
19 Ga0068857_100277745 3300005577 Bacteria 1540
20 Ga0070702_100289458 3300005615 Bacteria 1128
21 Ga0068862_100758317 3300005844 Bacteria 945
22 Ga0081538_10001256 3300005981 Bacteria 26461
23 Ga0068871_100008567 3300006358 Bacteria 7350
24 Ga0075428_100090970 3300006844 Bacteria 3329
25 Ga0075428_101080422 3300006844 Bacteria 848
26 Ga0075430_100326077 3300006846 Bacteria 1269
27 Ga0075431_100633606 3300006847 Bacteria 1051
28 Ga0075433_10765263 3300006852 Bacteria 844
29 Ga0075434_100300278 3300006871 Bacteria 1626
30 Ga0075429_100042801 3300006880 Bacteria 3941
31 Ga0075436_100126679 3300006914 Bacteria 1789
32 Ga0111539_10253191 3300009094 Bacteria 2050
33 Ga0111539_10254814 3300009094 Bacteria 2043
34 Ga0105249_10021860 3300009553 Bacteria 5729
35 Ga0105249_10483009 3300009553 Bacteria 1282
36 Ga0105249_12594722 3300009553 Bacteria 579
37 Ga0105239_11167673 3300010375 Bacteria 887
38 Ga0157370_10025701 3300013104 Bacteria 5826
39 Ga0157369_10021165 3300013105 Bacteria 7271
40 Ga0157369_10027316 3300013105 Bacteria 6327
41 Ga0157372_10021374 3300013307 Bacteria 6991
42 Ga0157375_10371419 3300013308 Bacteria 1597
43 Ga0157380_11683435 3300014326 Bacteria 691
44 Ga0213872_10045271 3300021361 Bacteria 2002
45 Ga0209233_1000015 3300025261 Bacteria 980563
46 Ga0209676_1080271 3300025292 Bacteria 746
47 Ga0209051_1014447 3300025303 Bacteria 3683
48 Ga0209257_1069927 3300025304 Bacteria 928
49 Ga0207705_10480945 3300025909 Bacteria 964
50 Ga0207652_10028295 3300025921 Bacteria 4676
51 Ga0207681_10345400 3300025923 Bacteria 1190
52 Ga0207712_10462845 3300025961 Bacteria 1078
53 Ga0207639_10000267 3300026041 Bacteria 37378
54 Ga0207678_10448597 3300026067 Bacteria 1121
55 Ga0207674_10010304 3300026116 Bacteria 10601
56 Ga0207674_10424690 3300026116 Bacteria 1284
57 Ga0207698_10795732 3300026142 Bacteria 947
58 Ga0209974_10056598 3300027876 Bacteria 1323
59 Ga0268266_10288678 3300028379 Bacteria 1527
60 Ga0268265_10215718 3300028380 Bacteria 1675
61 Ga0268265_10449570 3300028380 Bacteria 1203
62 Ga0265337_1006260 3300028556 Bacteria 4614
63 Ga0265324_10003449 3300029957 Bacteria 7521
64 Ga0265330_10212852 3300031235 Bacteria 816
65 Ga0265332_10207181 3300031238 Bacteria 814
66 Ga0265328_10006632 3300031239 Bacteria 4874
67 Ga0265328_10007170 3300031239 Bacteria 4666
68 Ga0265328_10011965 3300031239 Bacteria 3460
69 Ga0265328_10102550 3300031239 Bacteria 1060
70 Ga0265339_10165626 3300031249 Bacteria 1110
71 Ga0265331_10000641 3300031250 Bacteria 30240
72 Ga0265331_10008338 3300031250 Bacteria 5900
73 Ga0265331_10155008 3300031250 Bacteria 1039
74 Ga0265327_10000498 3300031251 Bacteria 68290
75 Ga0265327_10009666 3300031251 Bacteria 6916
76 Ga0265327_10129742 3300031251 Bacteria 1187
77 Ga0265316_10028636 3300031344 Bacteria 4592
78 Ga0265316_10053632 3300031344 Bacteria 3159
79 Ga0265316_10147030 3300031344 Bacteria 1767
80 Ga0265313_10154838 3300031595 Bacteria 977
81 Ga0316575_10017995 3300031665 Bacteria 2690
82 Ga0316579_10009010 3300031691 Bacteria 4185
83 Ga0316579_10041292 3300031691 Bacteria 2141
84 Ga0265314_10346161 3300031711 Bacteria 819
85 Ga0265342_10104900 3300031712 Bacteria 1606
86 Ga0316578_10055779 3300031728 Bacteria 2319
87 Ga0307405_10045652 3300031731 Bacteria 2687
88 Ga0307412_10449607 3300031911 Bacteria 1061
89 Ga0307409_100511237 3300031995 Bacteria 1172
90 Ga0307416_100827141 3300032002 Bacteria 1023
91 Ga0307415_100987484 3300032126 Bacteria 782
92 Ga0316583_10001864 3300032133 Bacteria 7177
93 Ga0373955_0106175 3300035172 Bacteria 1619
94 Ga0373955_0377044 3300035172 Bacteria 861
95 Ga0373935_0128681 3300035692 Bacteria 1699
96 Ga0373947_0254865 3300035725 Bacteria 1161
97 Ga0316582_0005996 3300036647 Bacteria 6330
98 Ga0316581_0003898 3300037588 Bacteria 3760
99 Ga0395901_0760387 3300038443 Bacteria 961
100 Ga0400486_22391 3300038742 Bacteria 2527
101 Ga0400486_29407 3300038742 Bacteria 5270
102 Ga0436361_0454948 3300039447 Bacteria 4653
103 Ga0439433_0073784 3300041999 Bacteria 824
104 Ga0439464_0207793 3300042439 Bacteria 626
105 Ga0451576_0146792 3300045051 Bacteria 2459
106 Ga0495592_0257819 3300046454 Bacteria 1150
107 Ga0495638_0026999 3300046460 Bacteria 3718
108 Ga0495651_0241909 3300046462 Bacteria 1237
109 Ga0495664_0425021 3300046477 Bacteria 797
110 Ga0495628_0341132 3300046516 Bacteria 1103
111 Ga0495586_0029210 3300046535 Bacteria 2951
112 Ga0495645_0600521 3300046543 Bacteria 677
113 Ga0495669_0069160 3300046684 Bacteria 1607
114 Ga0495613_0402286 3300046689 Bacteria 934
115 Ga0495602_0124618 3300048088 Bacteria 2067
116 Ga0495602_0174484 3300048088 Bacteria 1665
117 Ga0495602_0518911 3300048088 Bacteria 830
118 Ga0495626_0200678 3300048091 Bacteria 818
119 Ga0496113_0354217 3300048916 Bacteria 1178
120 Ga0501039_0755906 3300049575 Bacteria 759
121 Ga0501070_0427142 3300049586 Bacteria 1070
122 Ga0501072_0315828 3300049588 Bacteria 1242
123 Ga0501077_0297018 3300049593 Bacteria 1029
124 Ga0501080_0312088 3300049742 Bacteria 1425
125 Ga0501080_0484224 3300049742 Bacteria 1107
126 Ga0501044_0858380 3300049823 Bacteria 784
127 nmdc:mga0yw44_326722_c1 3300050492 Bacteria 1030
128 nmdc:mga09592_8101_c1 3300050508 Bacteria 8545
129 nmdc:mga0qj67_547900_c1 3300050509 Bacteria 928
130 nmdc:mga06r32_140874_c1 3300050510 Bacteria 2388
131 nmdc:mga08y16_1304331_c1 3300050511 Bacteria 693
132 nmdc:mga08y16_489364_c1 3300050511 Bacteria 1251
133 nmdc:mga0n895_200853_c1 3300050512 Bacteria 2025
134 nmdc:mga08x19_361286_c1 3300050514 Bacteria 1015
135 nmdc:mga0a205_40182_c1 3300050515 Bacteria 4503
136 Ga0495601_0011035 3300053077 Bacteria 5396
137 Ga0495595_0057077 3300053084 Bacteria 1821
138 Ga0500628_073122 3300053129 Bacteria 863
139 Ga0500616_0026997 3300053153 Bacteria 3174
140 Ga0501084_0000107 3300054114 Bacteria 62192
141 Ga0590071_122074 3300059421 Bacteria 666
142 Ga0590075_050495 3300059424 Bacteria 1067
143 Ga0501082_1235883 3300060353 Bacteria 653
144 Ga0530510_0520072 3300061734 Bacteria 903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0755906 Ga0501039_0755906_113_610 158
2 3300031911 Ga0307412_10449607 Ga0307412_104496072 159
3 3300046543 Ga0495645_0600521 Ga0495645_0600521_90_587 160
4 3300048088 Ga0495602_0518911 Ga0495602_0518911_148_645 160
5 iso_pu_bacteria 3004167301 3004168374 160
6 3300049742 Ga0501080_0484224 Ga0501080_0484224_444_944 161
7 iso_pu_bacteria 637000159 637076415 161
8 3300005539 Ga0068853_100000281 Ga0068853_1000002814 162
9 3300013105 Ga0157369_10021165 Ga0157369_100211654 162
10 3300026041 Ga0207639_10000267 Ga0207639_100002674 162
11 3300032126 Ga0307415_100987484 Ga0307415_1009874841 162
12 iso_pu_bacteria 2574179768 2574430548 162
13 3300031235 Ga0265330_10212852 Ga0265330_102128522 163
14 3300031238 Ga0265332_10207181 Ga0265332_102071812 163
15 3300031239 Ga0265328_10007170 Ga0265328_100071703 163
16 3300031344 Ga0265316_10147030 Ga0265316_101470301 163
17 3300038443 Ga0395901_0760387 Ga0395901_0760387_14_526 163
18 3300049823 Ga0501044_0858380 Ga0501044_0858380_21_521 163
19 3300010375 Ga0105239_11167673 Ga0105239_111676732 164
20 3300013105 Ga0157369_10027316 Ga0157369_100273165 164
21 3300013307 Ga0157372_10021374 Ga0157372_100213742 164
22 3300014326 Ga0157380_11683435 Ga0157380_116834352 164
23 3300026142 Ga0207698_10795732 Ga0207698_107957322 164
24 3300031249 Ga0265339_10165626 Ga0265339_101656261 164
25 3300031344 Ga0265316_10053632 Ga0265316_100536322 164
26 3300031711 Ga0265314_10346161 Ga0265314_103461612 164
27 3300031712 Ga0265342_10104900 Ga0265342_101049002 164
28 3300035692 Ga0373935_0128681 Ga0373935_0128681_526_1035 164
29 3300035725 Ga0373947_0254865 Ga0373947_0254865_519_1028 164
30 3300041999 Ga0439433_0073784 Ga0439433_0073784_139_633 164
31 3300046684 Ga0495669_0069160 Ga0495669_0069160_797_1306 164
32 3300049593 Ga0501077_0297018 Ga0501077_0297018_202_705 164
33 3300003214 JGI25165J46597_1000003 JGI25165J46597_1000003225 165
34 3300003792 Ga0055540_1062021 Ga0055540_10620211 165
35 3300003794 Ga0055531_10002352 Ga0055531_1000235219 165
36 3300005327 Ga0070658_10564500 Ga0070658_105645001 165
37 3300005337 Ga0070682_100159827 Ga0070682_1001598273 165
38 3300005340 Ga0070689_100119824 Ga0070689_1001198243 165
39 3300005353 Ga0070669_100082849 Ga0070669_1000828492 165
40 3300005353 Ga0070669_100518972 Ga0070669_1005189722 165
41 3300005356 Ga0070674_100058063 Ga0070674_1000580633 165
42 3300005366 Ga0070659_100023335 Ga0070659_1000233354 165
43 3300005436 Ga0070713_100180899 Ga0070713_1001808992 165
44 3300005440 Ga0070705_100428993 Ga0070705_1004289932 165
45 3300005530 Ga0070679_100043279 Ga0070679_1000432796 165
46 3300005546 Ga0070696_100013012 Ga0070696_1000130124 165
47 3300005548 Ga0070665_100348614 Ga0070665_1003486142 165
48 3300005563 Ga0068855_100220350 Ga0068855_1002203504 165
49 3300005577 Ga0068857_100004703 Ga0068857_10000470312 165
50 3300005577 Ga0068857_100277745 Ga0068857_1002777452 165
51 3300005615 Ga0070702_100289458 Ga0070702_1002894582 165
52 3300005844 Ga0068862_100758317 Ga0068862_1007583172 165
53 3300005981 Ga0081538_10001256 Ga0081538_1000125617 165
54 3300006358 Ga0068871_100008567 Ga0068871_1000085673 165
55 3300006844 Ga0075428_100090970 Ga0075428_1000909702 165
56 3300006844 Ga0075428_101080422 Ga0075428_1010804222 165
57 3300006846 Ga0075430_100326077 Ga0075430_1003260772 165
58 3300006847 Ga0075431_100633606 Ga0075431_1006336062 165
59 3300006852 Ga0075433_10765263 Ga0075433_107652632 165
60 3300006871 Ga0075434_100300278 Ga0075434_1003002782 165
61 3300006880 Ga0075429_100042801 Ga0075429_1000428012 165
62 3300006914 Ga0075436_100126679 Ga0075436_1001266792 165
63 3300009094 Ga0111539_10253191 Ga0111539_102531913 165
64 3300009094 Ga0111539_10254814 Ga0111539_102548142 165
65 3300009553 Ga0105249_10021860 Ga0105249_100218608 165
66 3300009553 Ga0105249_10483009 Ga0105249_104830092 165
67 3300009553 Ga0105249_12594722 Ga0105249_125947221 165
68 3300013104 Ga0157370_10025701 Ga0157370_100257016 165
69 3300013308 Ga0157375_10371419 Ga0157375_103714193 165
70 3300021361 Ga0213872_10045271 Ga0213872_100452712 165
71 3300025261 Ga0209233_1000015 Ga0209233_1000015556 165
72 3300025292 Ga0209676_1080271 Ga0209676_10802712 165
73 3300025303 Ga0209051_1014447 Ga0209051_10144475 165
74 3300025304 Ga0209257_1069927 Ga0209257_10699272 165
75 3300025909 Ga0207705_10480945 Ga0207705_104809452 165
76 3300025921 Ga0207652_10028295 Ga0207652_100282952 165
77 3300025923 Ga0207681_10345400 Ga0207681_103454002 165
78 3300025961 Ga0207712_10462845 Ga0207712_104628452 165
79 3300026067 Ga0207678_10448597 Ga0207678_104485972 165
80 3300026116 Ga0207674_10010304 Ga0207674_100103047 165
81 3300026116 Ga0207674_10424690 Ga0207674_104246902 165
82 3300027876 Ga0209974_10056598 Ga0209974_100565982 165
83 3300028379 Ga0268266_10288678 Ga0268266_102886782 165
84 3300028380 Ga0268265_10215718 Ga0268265_102157184 165
85 3300028380 Ga0268265_10449570 Ga0268265_104495702 165
86 3300028556 Ga0265337_1006260 Ga0265337_10062605 165
87 3300029957 Ga0265324_10003449 Ga0265324_100034495 165
88 3300031239 Ga0265328_10006632 Ga0265328_100066325 165
89 3300031239 Ga0265328_10011965 Ga0265328_100119652 165
90 3300031239 Ga0265328_10102550 Ga0265328_101025502 165
91 3300031250 Ga0265331_10000641 Ga0265331_100006415 165
92 3300031250 Ga0265331_10008338 Ga0265331_100083384 165
93 3300031250 Ga0265331_10155008 Ga0265331_101550081 165
94 3300031251 Ga0265327_10000498 Ga0265327_1000049832 165
95 3300031251 Ga0265327_10009666 Ga0265327_100096663 165
96 3300031251 Ga0265327_10129742 Ga0265327_101297422 165
97 3300031344 Ga0265316_10028636 Ga0265316_100286364 165
98 3300031595 Ga0265313_10154838 Ga0265313_101548382 165
99 3300031665 Ga0316575_10017995 Ga0316575_100179955 165
100 3300031691 Ga0316579_10009010 Ga0316579_100090106 165
101 3300031691 Ga0316579_10041292 Ga0316579_100412924 165
102 3300031728 Ga0316578_10055779 Ga0316578_100557793 165
103 3300031731 Ga0307405_10045652 Ga0307405_100456524 165
104 3300031995 Ga0307409_100511237 Ga0307409_1005112372 165
105 3300032002 Ga0307416_100827141 Ga0307416_1008271411 165
106 3300032133 Ga0316583_10001864 Ga0316583_100018648 165
107 3300035172 Ga0373955_0106175 Ga0373955_0106175_787_1314 165
108 3300035172 Ga0373955_0377044 Ga0373955_0377044_123_656 165
109 3300036647 Ga0316582_0005996 Ga0316582_0005996_2190_2729 165
110 3300037588 Ga0316581_0003898 Ga0316581_0003898_2412_2951 165
111 3300038742 Ga0400486_22391 Ga0400486_22391_585_1085 165
112 3300038742 Ga0400486_29407 Ga0400486_29407_790_1290 165
113 3300039447 Ga0436361_0454948 Ga0436361_0454948_2419_2919 165
114 3300042439 Ga0439464_0207793 Ga0439464_0207793_67_582 165
115 3300045051 Ga0451576_0146792 Ga0451576_0146792_1643_2257 165
116 3300046454 Ga0495592_0257819 Ga0495592_0257819_253_780 165
117 3300046460 Ga0495638_0026999 Ga0495638_0026999_427_936 165
118 3300046462 Ga0495651_0241909 Ga0495651_0241909_688_1215 165
119 3300046477 Ga0495664_0425021 Ga0495664_0425021_77_589 165
120 3300046516 Ga0495628_0341132 Ga0495628_0341132_121_633 165
121 3300046535 Ga0495586_0029210 Ga0495586_0029210_377_889 165
122 3300046689 Ga0495613_0402286 Ga0495613_0402286_125_688 165
123 3300048088 Ga0495602_0124618 Ga0495602_0124618_228_752 165
124 3300048088 Ga0495602_0174484 Ga0495602_0174484_887_1420 165
125 3300048091 Ga0495626_0200678 Ga0495626_0200678_110_643 165
126 3300048916 Ga0496113_0354217 Ga0496113_0354217_416_925 165
127 3300049586 Ga0501070_0427142 Ga0501070_0427142_546_1058 165
128 3300049588 Ga0501072_0315828 Ga0501072_0315828_288_824 165
129 3300049742 Ga0501080_0312088 Ga0501080_0312088_427_927 165
130 3300050492 nmdc:mga0yw44_326722_c1 nmdc:mga0yw44_326722_c1_56_577 165
131 3300050508 nmdc:mga09592_8101_c1 nmdc:mga09592_8101_c1_3219_3749 165
132 3300050509 nmdc:mga0qj67_547900_c1 nmdc:mga0qj67_547900_c1_160_690 165
133 3300050510 nmdc:mga06r32_140874_c1 nmdc:mga06r32_140874_c1_345_875 165
134 3300050511 nmdc:mga08y16_1304331_c1 nmdc:mga08y16_1304331_c1_84_614 165
135 3300050511 nmdc:mga08y16_489364_c1 nmdc:mga08y16_489364_c1_281_790 165
136 3300050512 nmdc:mga0n895_200853_c1 nmdc:mga0n895_200853_c1_1141_1671 165
137 3300050514 nmdc:mga08x19_361286_c1 nmdc:mga08x19_361286_c1_347_877 165
138 3300050515 nmdc:mga0a205_40182_c1 nmdc:mga0a205_40182_c1_3202_3732 165
139 3300053077 Ga0495601_0011035 Ga0495601_0011035_1978_2511 165
140 3300053084 Ga0495595_0057077 Ga0495595_0057077_1213_1746 165
141 3300053129 Ga0500628_073122 Ga0500628_073122_316_828 165
142 3300053153 Ga0500616_0026997 Ga0500616_0026997_1065_1574 165
143 3300054114 Ga0501084_0000107 Ga0501084_0000107_43617_44129 165
144 3300059421 Ga0590071_122074 Ga0590071_122074_52_561 165
145 3300059424 Ga0590075_050495 Ga0590075_050495_310_819 165
146 3300060353 Ga0501082_1235883 Ga0501082_1235883_22_558 165
147 3300061734 Ga0530510_0520072 Ga0530510_0520072_11_535 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

8

141

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9546 5 145
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9476 5 145
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9462 5 142
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9218 5 144
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9153 5 144
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8907 6 142 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8856 7 142 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.86 6 149 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8545 6 142 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8479 6 149 3.40.50.2300
ID Description Score Start End GO Terms
AF-V4R5R9-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9954 4 81 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1M3AD64-F1-model_v4 deleted 0.9879 3 84
AF-A9D0N4-F1-model_v4 Protein-tyrosine-phosphatase 0.9863 3 162 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A1B1AEV9-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9861 2 163 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A2G2G4D1-F1-model_v4 ArsR family transcriptional regulator 0.9846 2 158 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793

Feature Viewer

pLDDT pTM Quality
90.56 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map