F201041

General Info

Members Datasets Scaffolds Average Seq Length
147 114 294 186

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0002835|Ga0436363_0002835_21_623
Length 200
Sequence VKHDRELSRYGGTVTGMTTFTDRPNTALLVIDVQNDVVKEAHNRDGVVANIAALVDKARAGGVPVVWVQHSDDGLPRDTEGWEYVPELARADDEPLIHKNYGDSFEATDLEDVLAERKVGRLVVAGAQTDACIRSTLHGAIVRGYDATLVSDAHTTDDQSEWGAPPPDQVIAHTNLYWQWQSAPGRKGGTVKADDVDFAR

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
76 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
77 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
106 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
107 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
108 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
109 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
110 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
111 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
112 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
113 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
114 3006393351 Streptomyces sp. SID4985 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.2
Metatranscriptomes 2.72
Isolates 4.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0
Rhizoplane 8.84
Rhizosphere 77.55
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0002835 3300039450 Bacteria 1114
2 Ga0070658_10257254 3300005327 Bacteria 1482
3 Ga0070658_10957907 3300005327 Bacteria 744
4 Ga0070683_101324924 3300005329 Bacteria 692
5 Ga0068869_100384923 3300005334 Bacteria 1150
6 Ga0068868_100050023 3300005338 Bacteria 3281
7 Ga0070660_100107682 3300005339 Bacteria 2215
8 Ga0070661_100117680 3300005344 Bacteria 1988
9 Ga0070659_100000246 3300005366 Bacteria 42640
10 Ga0070659_100013810 3300005366 Bacteria 6023
11 Ga0070714_100077728 3300005435 Bacteria 2883
12 Ga0070713_100025172 3300005436 Bacteria 4649
13 Ga0070699_100000297 3300005518 Bacteria 47937
14 Ga0068855_100043869 3300005563 Bacteria 5295
15 Ga0068854_101382446 3300005578 Bacteria 636
16 Ga0068852_100260072 3300005616 Bacteria 1666
17 Ga0070717_10001517 3300006028 Bacteria 16076
18 Ga0075433_10355396 3300006852 Bacteria 1294
19 Ga0075435_100099615 3300007076 Bacteria 2407
20 Ga0105240_10058108 3300009093 Bacteria 4829
21 Ga0105240_10111412 3300009093 Bacteria 3310
22 Ga0111539_10656956 3300009094 Bacteria 1221
23 Ga0105245_10026566 3300009098 Bacteria 5097
24 Ga0105245_10340474 3300009098 Bacteria 1483
25 Ga0105237_10069802 3300009545 Bacteria 3509
26 Ga0105238_10201613 3300009551 Bacteria 1965
27 Ga0105238_11044209 3300009551 Unclassified 839
28 Ga0157371_10015377 3300013102 Bacteria 5743
29 Ga0157370_10006943 3300013104 Bacteria 12374
30 Ga0157370_10108269 3300013104 Bacteria 2599
31 Ga0157369_10000069 3300013105 Bacteria 143271
32 Ga0157369_10007659 3300013105 Bacteria 12422
33 Ga0157369_10026132 3300013105 Bacteria 6478
34 Ga0157369_10277576 3300013105 Bacteria 1745
35 Ga0157374_10017473 3300013296 Bacteria 6317
36 Ga0157374_10325357 3300013296 Bacteria 1524
37 Ga0163162_10264341 3300013306 Bacteria 1852
38 Ga0157372_10194636 3300013307 Bacteria 2349
39 Ga0157372_11252508 3300013307 Bacteria 856
40 Ga0157375_11100330 3300013308 Bacteria 930
41 Ga0182008_10316624 3300014497 Bacteria 820
42 Ga0182007_10010800 3300015262 Bacteria 3587
43 Ga0197907_10049168 3300020069 Bacteria 789
44 Ga0197907_10844889 3300020069 Bacteria 589
45 Ga0206350_10890653 3300020080 Bacteria 656
46 Ga0206354_10431462 3300020081 Bacteria 768
47 Ga0213874_10063846 3300021377 Bacteria 1160
48 Ga0213876_10379239 3300021384 Bacteria 752
49 Ga0207705_10206597 3300025909 Bacteria 1489
50 Ga0207695_10132445 3300025913 Bacteria 2449
51 Ga0207671_10039590 3300025914 Bacteria 3490
52 Ga0207657_10084367 3300025919 Bacteria 2663
53 Ga0207649_10094340 3300025920 Bacteria 1966
54 Ga0207652_10169368 3300025921 Bacteria 1959
55 Ga0207687_10087666 3300025927 Bacteria 2262
56 Ga0207687_10183181 3300025927 Bacteria 1624
57 Ga0207700_10018623 3300025928 Bacteria 4673
58 Ga0207690_10000065 3300025932 Bacteria 94536
59 Ga0207690_10033121 3300025932 Bacteria 3320
60 Ga0207689_10099008 3300025942 Bacteria 2396
61 Ga0207661_11199898 3300025944 Bacteria 698
62 Ga0207667_10282737 3300025949 Bacteria 1695
63 Ga0207651_10739558 3300025960 Bacteria 869
64 Ga0207677_10179811 3300026023 Bacteria 1663
65 Ga0307511_10070976 3300030521 Bacteria 2545
66 Ga0307513_10032899 3300031456 Bacteria 5839
67 Ga0307516_10002673 3300031730 Bacteria 23575
68 Ga0307405_10017584 3300031731 Bacteria 3927
69 Ga0307405_10850680 3300031731 Bacteria 768
70 Ga0307406_10004795 3300031901 Bacteria 7367
71 Ga0307407_10125794 3300031903 Bacteria 1632
72 Ga0307412_10326439 3300031911 Bacteria 1223
73 Ga0307409_100140764 3300031995 Bacteria 2078
74 Ga0307409_100959603 3300031995 Bacteria 871
75 Ga0307416_100000339 3300032002 Bacteria 24215
76 Ga0307411_10380784 3300032005 Bacteria 1160
77 Ga0307415_100000004 3300032126 Bacteria 114495
78 Ga0307415_100117468 3300032126 Bacteria 1987
79 Ga0395900_0243901 3300037418 Bacteria 1801
80 Ga0395898_0070550 3300037466 Bacteria 3377
81 Ga0395898_1196342 3300037466 Bacteria 691
82 Ga0395901_0209929 3300038443 Bacteria 2038
83 Ga0395901_0916773 3300038443 Bacteria 857
84 Ga0436365_1606906 3300039437 Bacteria 918
85 Ga0436365_1616419 3300039437 Bacteria 845
86 Ga0436363_0717547 3300039450 Bacteria 1188
87 Ga0436363_0803630 3300039450 Bacteria 713
88 Ga0451853_1303501 3300041512 Bacteria 1028
89 Ga0466972_0005181 3300044658 Bacteria 6527
90 Ga0466963_0019524 3300044694 Bacteria 4253
91 Ga0466964_0061989 3300044706 Bacteria 1558
92 Ga0466971_0138393 3300044719 Bacteria 1133
93 Ga0466971_0383679 3300044719 Bacteria 683
94 Ga0466958_0122835 3300045836 Bacteria 1626
95 Ga0466958_0523178 3300045836 Bacteria 770
96 Ga0466967_0028828 3300045976 Bacteria 4640
97 Ga0466967_0047388 3300045976 Bacteria 3746
98 Ga0466967_0533558 3300045976 Bacteria 1154
99 Ga0495635_0686388 3300046663 Bacteria 665
100 Ga0496102_0027537 3300048905 Bacteria 5076
101 Ga0496103_0005695 3300048906 Bacteria 7447
102 Ga0496106_0685844 3300048909 Unclassified 817
103 Ga0496108_0253871 3300048911 Bacteria 1530
104 Ga0496109_0026915 3300048912 Bacteria 5130
105 Ga0496109_0118576 3300048912 Bacteria 2464
106 Ga0496110_0045999 3300048913 Bacteria 3817
107 Ga0496110_0998116 3300048913 Bacteria 744
108 Ga0496111_0048116 3300048914 Bacteria 3072
109 Ga0496111_0521621 3300048914 Bacteria 874
110 Ga0496113_0158629 3300048916 Bacteria 1788
111 Ga0496113_0256431 3300048916 Bacteria 1397
112 Ga0496114_0039804 3300048917 Bacteria 3890
113 Ga0501031_0015144 3300049568 Bacteria 5007
114 Ga0501032_0010339 3300049569 Bacteria 6728
115 Ga0501033_0033505 3300049570 Bacteria 3856
116 Ga0501034_0003594 3300049571 Bacteria 17608
117 Ga0501036_0040516 3300049572 Bacteria 3940
118 Ga0501037_0018993 3300049573 Bacteria 5066
119 Ga0501038_0038736 3300049574 Bacteria 4172
120 Ga0501042_0006388 3300049578 Bacteria 7643
121 Ga0501043_0241649 3300049579 Bacteria 1392
122 Ga0501046_0032597 3300049580 Bacteria 4218
123 Ga0501046_0133642 3300049580 Bacteria 1880
124 Ga0501047_0053130 3300049581 Bacteria 3916
125 Ga0501048_0040900 3300049582 Bacteria 3320
126 Ga0501067_0078659 3300049583 Bacteria 1827
127 Ga0501068_0242127 3300049584 Bacteria 1148
128 Ga0501069_0417127 3300049585 Bacteria 795
129 Ga0501070_0783284 3300049586 Bacteria 750
130 Ga0501072_0247480 3300049588 Bacteria 1420
131 Ga0501035_0018739 3300049822 Bacteria 6374
132 Ga0501044_0024566 3300049823 Bacteria 6394
133 Ga0501044_0054876 3300049823 Bacteria 4093
134 Ga0501045_0750257 3300049824 Bacteria 719
135 nmdc:mga08y16_509719_c1 3300050511 Bacteria 1221
136 Ga0495601_0388134 3300053077 Bacteria 906
137 Ga0500635_0000023 3300053080 Bacteria 108024
138 Ga0500560_072938 3300053107 Bacteria 1133
139 Ga0500573_0016905 3300053140 Bacteria 4146
140 Ga0466962_0019669 3300061719 Bacteria 3245
141 Ga0466962_0024586 3300061719 Bacteria 2893
142 2867308076 2867302475 Bacteria 7087181
143 2867318515 2867312974 Bacteria 7058875
144 2867320499 2867319477 Bacteria 7069771
145 2891396614 2891395885 Bacteria 9251614
146 2891555756 2891554331 Bacteria 8812224
147 3006397890 3006393351 Bacteria 6615579
148 Ga0436363_0002835
149 Ga0070658_10257254
150 Ga0070658_10957907
151 Ga0070683_101324924
152 Ga0068869_100384923
153 Ga0068868_100050023
154 Ga0070660_100107682
155 Ga0070661_100117680
156 Ga0070659_100000246
157 Ga0070659_100013810
158 Ga0070714_100077728
159 Ga0070713_100025172
160 Ga0070699_100000297
161 Ga0068855_100043869
162 Ga0068854_101382446
163 Ga0068852_100260072
164 Ga0070717_10001517
165 Ga0075433_10355396
166 Ga0075435_100099615
167 Ga0105240_10058108
168 Ga0105240_10111412
169 Ga0111539_10656956
170 Ga0105245_10026566
171 Ga0105245_10340474
172 Ga0105237_10069802
173 Ga0105238_10201613
174 Ga0105238_11044209
175 Ga0157371_10015377
176 Ga0157370_10006943
177 Ga0157370_10108269
178 Ga0157369_10000069
179 Ga0157369_10007659
180 Ga0157369_10026132
181 Ga0157369_10277576
182 Ga0157374_10017473
183 Ga0157374_10325357
184 Ga0163162_10264341
185 Ga0157372_10194636
186 Ga0157372_11252508
187 Ga0157375_11100330
188 Ga0182008_10316624
189 Ga0182007_10010800
190 Ga0197907_10049168
191 Ga0197907_10844889
192 Ga0206350_10890653
193 Ga0206354_10431462
194 Ga0213874_10063846
195 Ga0213876_10379239
196 Ga0207705_10206597
197 Ga0207695_10132445
198 Ga0207671_10039590
199 Ga0207657_10084367
200 Ga0207649_10094340
201 Ga0207652_10169368
202 Ga0207687_10087666
203 Ga0207687_10183181
204 Ga0207700_10018623
205 Ga0207690_10000065
206 Ga0207690_10033121
207 Ga0207689_10099008
208 Ga0207661_11199898
209 Ga0207667_10282737
210 Ga0207651_10739558
211 Ga0207677_10179811
212 Ga0307511_10070976
213 Ga0307513_10032899
214 Ga0307516_10002673
215 Ga0307405_10017584
216 Ga0307405_10850680
217 Ga0307406_10004795
218 Ga0307407_10125794
219 Ga0307412_10326439
220 Ga0307409_100140764
221 Ga0307409_100959603
222 Ga0307416_100000339
223 Ga0307411_10380784
224 Ga0307415_100000004
225 Ga0307415_100117468
226 Ga0395900_0243901
227 Ga0395898_0070550
228 Ga0395898_1196342
229 Ga0395901_0209929
230 Ga0395901_0916773
231 Ga0436365_1606906
232 Ga0436365_1616419
233 Ga0436363_0717547
234 Ga0436363_0803630
235 Ga0451853_1303501
236 Ga0466972_0005181
237 Ga0466963_0019524
238 Ga0466964_0061989
239 Ga0466971_0138393
240 Ga0466971_0383679
241 Ga0466958_0122835
242 Ga0466958_0523178
243 Ga0466967_0028828
244 Ga0466967_0047388
245 Ga0466967_0533558
246 Ga0495635_0686388
247 Ga0496102_0027537
248 Ga0496103_0005695
249 Ga0496106_0685844
250 Ga0496108_0253871
251 Ga0496109_0026915
252 Ga0496109_0118576
253 Ga0496110_0045999
254 Ga0496110_0998116
255 Ga0496111_0048116
256 Ga0496111_0521621
257 Ga0496113_0158629
258 Ga0496113_0256431
259 Ga0496114_0039804
260 Ga0501031_0015144
261 Ga0501032_0010339
262 Ga0501033_0033505
263 Ga0501034_0003594
264 Ga0501036_0040516
265 Ga0501037_0018993
266 Ga0501038_0038736
267 Ga0501042_0006388
268 Ga0501043_0241649
269 Ga0501046_0032597
270 Ga0501046_0133642
271 Ga0501047_0053130
272 Ga0501048_0040900
273 Ga0501067_0078659
274 Ga0501068_0242127
275 Ga0501069_0417127
276 Ga0501070_0783284
277 Ga0501072_0247480
278 Ga0501035_0018739
279 Ga0501044_0024566
280 Ga0501044_0054876
281 Ga0501045_0750257
282 nmdc:mga08y16_509719_c1
283 Ga0495601_0388134
284 Ga0500635_0000023
285 Ga0500560_072938
286 Ga0500573_0016905
287 Ga0466962_0019669
288 Ga0466962_0024586
289 2867308076
290 2867318515
291 2867320499
292 2891396614
293 2891555756
294 3006397890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

26

164

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hwg-assembly1.cif.gz_A structure of a cysteine hydrolase with a negative substrate 0.9418 9 181
5ha8-assembly1.cif.gz_A-2 structure of a cysteine hydrolase 0.94 9 181
5hwg-assembly1.cif.gz_A structure of a cysteine hydrolase with a negative substrate 0.921 9 181
5ha8-assembly1.cif.gz_A-2 structure of a cysteine hydrolase 0.9193 9 181
2a67-assembly1.cif.gz_A crystal structure of isochorismatase family protein 0.8885 7 176
ID Description Score Start End Superfamily
2a67C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8955 9 176 3.40.50.850
af_B0G192_1_183_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8863 9 178 3.40.50.850
3irvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8762 6 178 3.40.50.850
2a67C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8748 9 176 3.40.50.850
4h17B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8639 9 181 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A2H1KAL9-F1-model_v4 Nicotinamidase-related amidase 0.9767 7 183 GO:0016787
AF-A0A2H1KW59-F1-model_v4 Nicotinamidase-related amidase 0.9764 7 183 GO:0016787
AF-I2IH30-F1-model_v4 deleted 0.9753 25 182
AF-A0A359HED1-F1-model_v4 Cysteine hydrolase 0.9738 9 141 GO:0016787
AF-H0QP25-F1-model_v4 Isochorismatase family protein 0.9731 1 184 GO:0016810

Map