F200828

General Info

Members Datasets Scaffolds Average Seq Length
147 118 294 112

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10000046|Ga0307516_1000004692
Length 122
Sequence MAKHLEPLPDVFYALGDPTRLAIVGELGRGPATVSALAAPFTMALPSFMKHLSVLERSNLIRSRKVGRVRTCELVPKTLTQAHSWLNAQRALWHARSDRMASFVETLHQEDLSREQPNRRKT

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
63 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
64 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
74 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
75 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
76 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
77 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
78 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
79 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
87 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
88 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
104 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
105 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
106 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
107 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
108 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
112 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
113 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
114 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
115 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
116 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
117 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
118 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.92
Metatranscriptomes 0
Isolates 4.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.69
Nodule 0
Rhizoplane 2.04
Rhizosphere 72.79
Stem 0
Stem Tuber 0.68
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10000046 3300031730 Bacteria 130851
2 Ga0070683_100152453 3300005329 Bacteria 2191
3 Ga0070682_100713694 3300005337 Archaea 805
4 Ga0070673_100583075 3300005364 Bacteria 1018
5 Ga0070667_100291594 3300005367 Unclassified 1467
6 Ga0070678_100900689 3300005456 Bacteria 809
7 Ga0068853_100094131 3300005539 Bacteria 2639
8 Ga0070672_101726357 3300005543 Archaea 562
9 Ga0070665_100011677 3300005548 Bacteria 8874
10 Ga0070665_100164728 3300005548 Bacteria 2219
11 Ga0070665_100488845 3300005548 Archaea 1242
12 Ga0068855_100190014 3300005563 Bacteria 2317
13 Ga0068857_100012243 3300005577 Bacteria 7462
14 Ga0068857_102460010 3300005577 Bacteria 511
15 Ga0068856_101107119 3300005614 Bacteria 809
16 Ga0068852_100779136 3300005616 Bacteria 970
17 Ga0068859_100532683 3300005617 Bacteria 1269
18 Ga0068864_101969538 3300005618 Unclassified 590
19 Ga0068851_10061585 3300005834 Bacteria 1924
20 Ga0068860_100005233 3300005843 Bacteria 13177
21 Ga0075365_10126185 3300006038 Bacteria 1768
22 Ga0075363_100041006 3300006048 Bacteria 2441
23 Ga0075363_100450666 3300006048 Bacteria 760
24 Ga0075364_10032989 3300006051 Bacteria 3331
25 Ga0075364_10679552 3300006051 Unclassified 703
26 Ga0075362_10395805 3300006177 Unclassified 696
27 Ga0075369_10147847 3300006186 Bacteria 1073
28 Ga0075370_10068137 3300006353 Bacteria 2032
29 Ga0075430_100070145 3300006846 Bacteria 2939
30 Ga0075430_100253832 3300006846 Bacteria 1457
31 Ga0075431_101823993 3300006847 Bacteria 564
32 Ga0075429_100245870 3300006880 Bacteria 1566
33 Ga0097620_100532713 3300006931 Bacteria 1269
34 Ga0105240_10954665 3300009093 Bacteria 919
35 Ga0105240_12044584 3300009093 Bacteria 595
36 Ga0111539_10002139 3300009094 Bacteria 26440
37 Ga0111539_10440339 3300009094 Bacteria 1517
38 Ga0111539_10487985 3300009094 Bacteria 1435
39 Ga0114129_10634389 3300009147 Bacteria 1381
40 Ga0105238_10714656 3300009551 Bacteria 1014
41 Ga0105238_12628373 3300009551 Bacteria 540
42 Ga0105249_11499080 3300009553 Unclassified 747
43 Ga0105239_10737170 3300010375 Bacteria 1127
44 Ga0105246_12199785 3300011119 Bacteria 537
45 Ga0171462_1004 3300013250 Bacteria 678877
46 Ga0157375_10168489 3300013308 Bacteria 2336
47 Ga0157375_12042032 3300013308 Unclassified 682
48 Ga0163163_12596099 3300014325 Bacteria 564
49 Ga0163163_13085877 3300014325 Archaea 519
50 Ga0157380_12007505 3300014326 Bacteria 640
51 Ga0157379_11343579 3300014968 Bacteria 691
52 Ga0157376_10480835 3300014969 Bacteria 1217
53 Ga0163161_10126283 3300017792 Bacteria 1926
54 Ga0207695_10668464 3300025913 Bacteria 919
55 Ga0207681_11216189 3300025923 Unclassified 633
56 Ga0207694_11476175 3300025924 Bacteria 574
57 Ga0207661_10306294 3300025944 Unclassified 1425
58 Ga0207651_10275546 3300025960 Bacteria 1388
59 Ga0207712_10498231 3300025961 Bacteria 1041
60 Ga0207668_10014022 3300025972 Bacteria 4954
61 Ga0207668_11625724 3300025972 Bacteria 583
62 Ga0207658_10287874 3300025986 Bacteria 1411
63 Ga0207639_10011533 3300026041 Bacteria 6141
64 Ga0207678_10624595 3300026067 Bacteria 945
65 Ga0207708_10315454 3300026075 Bacteria 1274
66 Ga0207702_10727277 3300026078 Bacteria 979
67 Ga0207676_12298503 3300026095 Unclassified 537
68 Ga0207674_10059376 3300026116 Bacteria 3870
69 Ga0207674_11634263 3300026116 Bacteria 613
70 Ga0207683_11743216 3300026121 Unclassified 572
71 Ga0207698_11517364 3300026142 Bacteria 685
72 Ga0207428_10016124 3300027907 Bacteria 6437
73 Ga0268266_10161842 3300028379 Bacteria 2025
74 Ga0268266_10457903 3300028379 Bacteria 1213
75 Ga0268266_11539028 3300028379 Unclassified 641
76 Ga0268266_11554119 3300028379 Archaea 637
77 Ga0268264_10003536 3300028381 Bacteria 13454
78 Ga0268264_10287061 3300028381 Bacteria 1544
79 Ga0307515_10008172 3300028794 Bacteria 20484
80 Ga0307515_10861860 3300028794 Bacteria 533
81 Ga0316176_1142090 3300030732 Bacteria 1228
82 Ga0316179_1020233 3300030734 Bacteria 3185
83 Ga0316181_1218890 3300030744 Bacteria 563
84 Ga0307513_10065949 3300031456 Bacteria 3807
85 Ga0307513_10167547 3300031456 Bacteria 2078
86 Ga0307413_10089714 3300031824 Bacteria 1998
87 Ga0307406_10663828 3300031901 Bacteria 867
88 Ga0307407_11113804 3300031903 Bacteria 614
89 Ga0307409_102018713 3300031995 Bacteria 606
90 Ga0307416_101369007 3300032002 Bacteria 813
91 Ga0307415_100822469 3300032126 Bacteria 850
92 Ga0395898_1303158 3300037466 Bacteria 656
93 Ga0439465_0343562 3300041413 Bacteria 563
94 Ga0451797_1012202 3300041453 Unclassified 742
95 Ga0451837_1575185 3300041494 Bacteria 657
96 Ga0450914_064632 3300042118 Bacteria 501
97 Ga0450898_013754 3300042134 Unclassified 1353
98 Ga0450909_058491 3300042185 Bacteria 607
99 Ga0439440_0228158 3300042993 Bacteria 561
100 Ga0495638_0277830 3300046460 Unclassified 911
101 Ga0495616_0173998 3300046513 Bacteria 961
102 Ga0495620_0322875 3300046515 Bacteria 586
103 Ga0495625_0418071 3300046660 Bacteria 834
104 Ga0495661_0355638 3300046665 Bacteria 720
105 Ga0496102_0940113 3300048905 Bacteria 786
106 Ga0496106_0002676 3300048909 Bacteria 13247
107 Ga0496119_0016177 3300048922 Bacteria 5697
108 Ga0496122_0016632 3300048925 Bacteria 6941
109 Ga0501033_0038137 3300049570 Bacteria 3595
110 Ga0501034_0080975 3300049571 Bacteria 3250
111 Ga0501034_0515188 3300049571 Bacteria 1108
112 Ga0501037_0127429 3300049573 Bacteria 1827
113 Ga0501047_1093820 3300049581 Bacteria 610
114 Ga0501069_0206614 3300049585 Bacteria 1139
115 Ga0501073_0359352 3300049589 Bacteria 1006
116 Ga0501080_0266470 3300049742 Bacteria 1560
117 Ga0501035_0793071 3300049822 Bacteria 757
118 nmdc:mga03n38_148998_c1 3300050490 Bacteria 1176
119 nmdc:mga03n38_58796_c1 3300050490 Bacteria 1743
120 nmdc:mga00v17_122863_c1 3300050491 Bacteria 1654
121 nmdc:mga00v17_399982_c1 3300050491 Bacteria 892
122 nmdc:mga00v17_48841_c1 3300050491 Bacteria 2565
123 nmdc:mga00v17_522359_c1 3300050491 Bacteria 769
124 nmdc:mga09592_171969_c1 3300050508 Bacteria 1873
125 nmdc:mga0qj67_387776_c1 3300050509 Bacteria 1128
126 nmdc:mga0qj67_6545_c1 3300050509 Bacteria 8557
127 nmdc:mga06r32_1725163_c1 3300050510 Bacteria 563
128 nmdc:mga08y16_14371_c1 3300050511 Bacteria 8333
129 nmdc:mga08y16_332186_c1 3300050511 Bacteria 1563
130 nmdc:mga0sz30_164821_c1 3300050516 Bacteria 982
131 Ga0500644_0334848 3300053088 Bacteria 653
132 Ga0500566_0474399 3300053094 Bacteria 543
133 Ga0500562_169970 3300053108 Bacteria 593
134 Ga0500593_105499 3300053117 Bacteria 1168
135 Ga0500658_0007056 3300053134 Bacteria 4158
136 Ga0500568_0008579 3300053139 Bacteria 4915
137 Ga0500604_0021290 3300053151 Bacteria 1832
138 Ga0500604_0193099 3300053151 Unclassified 700
139 Ga0500616_0002425 3300053153 Bacteria 15524
140 Ga0500616_0016290 3300053153 Bacteria 4234
141 Ga0500633_0007712 3300053160 Bacteria 2729
142 2512032145 2511231221 Bacteria 6846400
143 2676479433 2675903059 Bacteria 8644972
144 2760621089 2758568621 Bacteria 5967089
145 2899372093 2899370129 Bacteria 6781179
146 2917737166 2917736166 Bacteria 9690793
147 2939660098 2939657138 Bacteria 3740283
148 Ga0307516_10000046
149 Ga0070683_100152453
150 Ga0070682_100713694
151 Ga0070673_100583075
152 Ga0070667_100291594
153 Ga0070678_100900689
154 Ga0068853_100094131
155 Ga0070672_101726357
156 Ga0070665_100011677
157 Ga0070665_100164728
158 Ga0070665_100488845
159 Ga0068855_100190014
160 Ga0068857_100012243
161 Ga0068857_102460010
162 Ga0068856_101107119
163 Ga0068852_100779136
164 Ga0068859_100532683
165 Ga0068864_101969538
166 Ga0068851_10061585
167 Ga0068860_100005233
168 Ga0075365_10126185
169 Ga0075363_100041006
170 Ga0075363_100450666
171 Ga0075364_10032989
172 Ga0075364_10679552
173 Ga0075362_10395805
174 Ga0075369_10147847
175 Ga0075370_10068137
176 Ga0075430_100070145
177 Ga0075430_100253832
178 Ga0075431_101823993
179 Ga0075429_100245870
180 Ga0097620_100532713
181 Ga0105240_10954665
182 Ga0105240_12044584
183 Ga0111539_10002139
184 Ga0111539_10440339
185 Ga0111539_10487985
186 Ga0114129_10634389
187 Ga0105238_10714656
188 Ga0105238_12628373
189 Ga0105249_11499080
190 Ga0105239_10737170
191 Ga0105246_12199785
192 Ga0171462_1004
193 Ga0157375_10168489
194 Ga0157375_12042032
195 Ga0163163_12596099
196 Ga0163163_13085877
197 Ga0157380_12007505
198 Ga0157379_11343579
199 Ga0157376_10480835
200 Ga0163161_10126283
201 Ga0207695_10668464
202 Ga0207681_11216189
203 Ga0207694_11476175
204 Ga0207661_10306294
205 Ga0207651_10275546
206 Ga0207712_10498231
207 Ga0207668_10014022
208 Ga0207668_11625724
209 Ga0207658_10287874
210 Ga0207639_10011533
211 Ga0207678_10624595
212 Ga0207708_10315454
213 Ga0207702_10727277
214 Ga0207676_12298503
215 Ga0207674_10059376
216 Ga0207674_11634263
217 Ga0207683_11743216
218 Ga0207698_11517364
219 Ga0207428_10016124
220 Ga0268266_10161842
221 Ga0268266_10457903
222 Ga0268266_11539028
223 Ga0268266_11554119
224 Ga0268264_10003536
225 Ga0268264_10287061
226 Ga0307515_10008172
227 Ga0307515_10861860
228 Ga0316176_1142090
229 Ga0316179_1020233
230 Ga0316181_1218890
231 Ga0307513_10065949
232 Ga0307513_10167547
233 Ga0307413_10089714
234 Ga0307406_10663828
235 Ga0307407_11113804
236 Ga0307409_102018713
237 Ga0307416_101369007
238 Ga0307415_100822469
239 Ga0395898_1303158
240 Ga0439465_0343562
241 Ga0451797_1012202
242 Ga0451837_1575185
243 Ga0450914_064632
244 Ga0450898_013754
245 Ga0450909_058491
246 Ga0439440_0228158
247 Ga0495638_0277830
248 Ga0495616_0173998
249 Ga0495620_0322875
250 Ga0495625_0418071
251 Ga0495661_0355638
252 Ga0496102_0940113
253 Ga0496106_0002676
254 Ga0496119_0016177
255 Ga0496122_0016632
256 Ga0501033_0038137
257 Ga0501034_0080975
258 Ga0501034_0515188
259 Ga0501037_0127429
260 Ga0501047_1093820
261 Ga0501069_0206614
262 Ga0501073_0359352
263 Ga0501080_0266470
264 Ga0501035_0793071
265 nmdc:mga03n38_148998_c1
266 nmdc:mga03n38_58796_c1
267 nmdc:mga00v17_122863_c1
268 nmdc:mga00v17_399982_c1
269 nmdc:mga00v17_48841_c1
270 nmdc:mga00v17_522359_c1
271 nmdc:mga09592_171969_c1
272 nmdc:mga0qj67_387776_c1
273 nmdc:mga0qj67_6545_c1
274 nmdc:mga06r32_1725163_c1
275 nmdc:mga08y16_14371_c1
276 nmdc:mga08y16_332186_c1
277 nmdc:mga0sz30_164821_c1
278 Ga0500644_0334848
279 Ga0500566_0474399
280 Ga0500562_169970
281 Ga0500593_105499
282 Ga0500658_0007056
283 Ga0500568_0008579
284 Ga0500604_0021290
285 Ga0500604_0193099
286 Ga0500616_0002425
287 Ga0500616_0016290
288 Ga0500633_0007712
289 2512032145
290 2676479433
291 2760621089
292 2899372093
293 2917737166
294 2939660098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

17

63

0.98

PF12840

HTH_20

Helix-turn-helix domain

15

64

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9684 7 94
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9512 6 88
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9456 1 94
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9365 4 91
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.9317 13 88
ID Description Score Start End Superfamily
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9684 7 94 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9351 5 87 1.10.10.10
3f6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9317 13 88 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9279 6 84 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9273 7 94 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A529AIH0-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9915 8 87 GO:0003700
AF-A0A238K834-F1-model_v4 Transcriptional repressor SdpR 0.987 8 98 GO:0003700
AF-A0A536P9H2-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9842 5 96 GO:0003700
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.9842 6 87 GO:0003700
AF-A0A0Q6KGI1-F1-model_v4 ArsR family transcriptional regulator 0.9835 7 110 GO:0003700

Map