F200612

General Info

Members Datasets Scaffolds Average Seq Length
147 89 294 153

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10004094|Ga0207708_100040942
Length 180
Sequence MRSARAKRCHSITSSNGLQLMTSGEMGSEVKLRPVRPNIYLPVVRFGVADSDWLSVLLISCASYLAPIPFGITVLYVPLQMWSWLLATAGSIAFFNYIRIGRRPYWLPHKLKSIWLHHRQYPALPNGKKRRFRSSWLLDSESSVPGDHSQKQQPSPFTSRQHLALVMDHNYEVQEAWNER

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
89 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.32
Stem 0
Stem Tuber 0
Unclassified 34.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10004094 3300026075 Bacteria 10728
2 LJNas_1004286 3300000546 Unclassified 1587
3 Ga0065712_10152684 3300005290 Bacteria 1358
4 Ga0065715_10002186 3300005293 Bacteria 9483
5 Ga0065707_10086024 3300005295 Bacteria 5712
6 Ga0070670_100125520 3300005331 Unclassified 2215
7 Ga0070680_100002107 3300005336 Bacteria 14683
8 Ga0070682_100000070 3300005337 Bacteria 94838
9 Ga0070689_100000108 3300005340 Bacteria 48035
10 Ga0070689_100019728 3300005340 Bacteria 4988
11 Ga0070669_100025245 3300005353 Bacteria 4268
12 Ga0070671_100000252 3300005355 Bacteria 35895
13 Ga0070673_100315217 3300005364 Unclassified 1380
14 Ga0070703_10015585 3300005406 Unclassified 2176
15 Ga0070701_10075965 3300005438 Bacteria 1807
16 Ga0070701_10925191 3300005438 Unclassified 603
17 Ga0070705_100079736 3300005440 Unclassified 2006
18 Ga0070705_100351726 3300005440 Unclassified 1074
19 Ga0070700_100003203 3300005441 Bacteria 8413
20 Ga0070700_100023260 3300005441 Unclassified 3623
21 Ga0070694_100000115 3300005444 Bacteria 39032
22 Ga0070694_100032793 3300005444 Bacteria 3413
23 Ga0070694_100080691 3300005444 Unclassified 2261
24 Ga0070694_100745438 3300005444 Bacteria 799
25 Ga0070708_100465695 3300005445 Bacteria 1192
26 Ga0070708_100959532 3300005445 Unclassified 802
27 Ga0070708_102240372 3300005445 Unclassified 504
28 Ga0070681_10000035 3300005458 Bacteria 97925
29 Ga0068867_101042434 3300005459 Bacteria 744
30 Ga0070706_100000183 3300005467 Bacteria 79089
31 Ga0070706_100000615 3300005467 Bacteria 41174
32 Ga0070706_100001134 3300005467 Bacteria 28771
33 Ga0070706_100102182 3300005467 Unclassified 2665
34 Ga0070706_100284812 3300005467 Bacteria 1542
35 Ga0070706_101419437 3300005467 Unclassified 635
36 Ga0070707_100000098 3300005468 Bacteria 79084
37 Ga0070707_100000741 3300005468 Bacteria 32330
38 Ga0070698_100053048 3300005471 Bacteria 4122
39 Ga0070698_100114035 3300005471 Bacteria 2668
40 Ga0070698_100375927 3300005471 Unclassified 1353
41 Ga0070698_101560554 3300005471 Bacteria 612
42 Ga0070699_100064742 3300005518 Bacteria 3171
43 Ga0070699_100301665 3300005518 Bacteria 1437
44 Ga0070699_100780167 3300005518 Unclassified 874
45 Ga0070699_101164909 3300005518 Unclassified 707
46 Ga0070679_100000072 3300005530 Bacteria 75252
47 Ga0070697_100000200 3300005536 Bacteria 48972
48 Ga0068853_101733919 3300005539 Unclassified 605
49 Ga0070672_100576835 3300005543 Unclassified 978
50 Ga0070695_100284538 3300005545 Unclassified 1216
51 Ga0070696_100216587 3300005546 Unclassified 1435
52 Ga0070704_100005083 3300005549 Bacteria 7652
53 Ga0070704_100053469 3300005549 Bacteria 2854
54 Ga0068857_100875178 3300005577 Bacteria 860
55 Ga0068857_100960809 3300005577 Unclassified 821
56 Ga0068852_101467592 3300005616 Bacteria 704
57 Ga0068859_100000128 3300005617 Bacteria 72119
58 Ga0068859_100001059 3300005617 Bacteria 28152
59 Ga0068859_100142244 3300005617 Unclassified 2473
60 Ga0068859_100572126 3300005617 Unclassified 1224
61 Ga0068864_101913367 3300005618 Unclassified 599
62 Ga0068866_10229402 3300005718 Bacteria 1125
63 Ga0068861_100281917 3300005719 Unclassified 1431
64 Ga0068870_10007235 3300005840 Bacteria 4942
65 Ga0068863_100012038 3300005841 Bacteria 8357
66 Ga0068858_100159288 3300005842 Bacteria 2125
67 Ga0068858_100842084 3300005842 Unclassified 896
68 Ga0068860_100118181 3300005843 Bacteria 2537
69 Ga0068860_100126018 3300005843 Bacteria 2454
70 Ga0068860_100519654 3300005843 Bacteria 1190
71 Ga0068860_100831661 3300005843 Unclassified 937
72 Ga0068860_101203953 3300005843 Bacteria 778
73 Ga0068862_100852405 3300005844 Unclassified 893
74 Ga0081539_10006824 3300005985 Bacteria 10691
75 Ga0070716_100155996 3300006173 Bacteria 1474
76 Ga0068865_100478174 3300006881 Unclassified 1035
77 Ga0075436_100000157 3300006914 Bacteria 42464
78 Ga0097620_100000079 3300006931 Bacteria 90756
79 Ga0097620_100000128 3300006931 Bacteria 72119
80 Ga0097620_100000395 3300006931 Bacteria 43422
81 Ga0097620_100001059 3300006931 Bacteria 28152
82 Ga0097620_100142241 3300006931 Unclassified 2473
83 Ga0097620_100572084 3300006931 Unclassified 1224
84 Ga0075435_100001515 3300007076 Bacteria 14942
85 Ga0075435_101528193 3300007076 Unclassified 585
86 Ga0105247_10232115 3300009101 Unclassified 1253
87 Ga0105247_10234108 3300009101 Unclassified 1248
88 Ga0114129_10975366 3300009147 Bacteria 1069
89 Ga0114129_11563396 3300009147 Bacteria 809
90 Ga0114129_12131175 3300009147 Unclassified 676
91 Ga0105243_10378242 3300009148 Unclassified 1309
92 Ga0105241_10788434 3300009174 Bacteria 874
93 Ga0105248_10000922 3300009177 Bacteria 32717
94 Ga0105248_10015426 3300009177 Bacteria 8422
95 Ga0157373_10545840 3300013100 Unclassified 840
96 Ga0157378_12150134 3300013297 Unclassified 609
97 Ga0163163_10374556 3300014325 Unclassified 1481
98 Ga0207653_10000072 3300025885 Bacteria 74068
99 Ga0207653_10029609 3300025885 Bacteria 1764
100 Ga0207710_10000335 3300025900 Bacteria 35220
101 Ga0207643_10003401 3300025908 Bacteria 8580
102 Ga0207684_10000175 3300025910 Bacteria 106336
103 Ga0207684_10003213 3300025910 Bacteria 16042
104 Ga0207684_10006490 3300025910 Bacteria 10664
105 Ga0207684_10067614 3300025910 Bacteria 3037
106 Ga0207684_11491831 3300025910 Bacteria 551
107 Ga0207707_10000017 3300025912 Bacteria 237068
108 Ga0207660_11023665 3300025917 Bacteria 673
109 Ga0207652_10000120 3300025921 Bacteria 86585
110 Ga0207646_10000081 3300025922 Bacteria 128933
111 Ga0207646_10002102 3300025922 Bacteria 23873
112 Ga0207681_10016165 3300025923 Bacteria 4662
113 Ga0207694_10042004 3300025924 Bacteria 3525
114 Ga0207650_10173656 3300025925 Unclassified 1714
115 Ga0207644_10002894 3300025931 Bacteria 11065
116 Ga0207706_10523369 3300025933 Unclassified 1022
117 Ga0207686_10000024 3300025934 Bacteria 171857
118 Ga0207709_10000012 3300025935 Bacteria 552803
119 Ga0207670_10000495 3300025936 Bacteria 21757
120 Ga0207670_10000830 3300025936 Bacteria 16177
121 Ga0207665_10130832 3300025939 Bacteria 1781
122 Ga0207711_10001148 3300025941 Bacteria 25249
123 Ga0207711_10718857 3300025941 Unclassified 931
124 Ga0207689_10347761 3300025942 Bacteria 1232
125 Ga0207689_11036185 3300025942 Unclassified 692
126 Ga0207651_11173860 3300025960 Bacteria 689
127 Ga0207639_11156417 3300026041 Bacteria 726
128 Ga0207708_10003603 3300026075 Bacteria 11414
129 Ga0207708_11795324 3300026075 Unclassified 538
130 Ga0207702_11210487 3300026078 Bacteria 749
131 Ga0207641_10004437 3300026088 Bacteria 12157
132 Ga0207641_10558882 3300026088 Bacteria 1117
133 Ga0207648_10781075 3300026089 Bacteria 888
134 Ga0207676_10010788 3300026095 Bacteria 6516
135 Ga0207675_100071975 3300026118 Bacteria 3233
136 Ga0207675_100122296 3300026118 Bacteria 2463
137 Ga0207675_100313372 3300026118 Unclassified 1530
138 Ga0207698_10289112 3300026142 Bacteria 1520
139 Ga0207698_11523744 3300026142 Unclassified 684
140 Ga0268264_10091365 3300028381 Bacteria 2626
141 Ga0268264_10167204 3300028381 Bacteria 1986
142 Ga0268264_10768213 3300028381 Unclassified 961
143 Ga0307513_10324573 3300031456 Unclassified 1296
144 Ga0307414_10598332 3300032004 Unclassified 989
145 Ga0453683_0265432 3300044673 Unclassified 1095
146 nmdc:mga0rr50_2441_c1 3300050513 Bacteria 10483
147 nmdc:mga08x19_205_c1 3300050514 Bacteria 45381
148 Ga0207708_10004094
149 LJNas_1004286
150 Ga0065712_10152684
151 Ga0065715_10002186
152 Ga0065707_10086024
153 Ga0070670_100125520
154 Ga0070680_100002107
155 Ga0070682_100000070
156 Ga0070689_100000108
157 Ga0070689_100019728
158 Ga0070669_100025245
159 Ga0070671_100000252
160 Ga0070673_100315217
161 Ga0070703_10015585
162 Ga0070701_10075965
163 Ga0070701_10925191
164 Ga0070705_100079736
165 Ga0070705_100351726
166 Ga0070700_100003203
167 Ga0070700_100023260
168 Ga0070694_100000115
169 Ga0070694_100032793
170 Ga0070694_100080691
171 Ga0070694_100745438
172 Ga0070708_100465695
173 Ga0070708_100959532
174 Ga0070708_102240372
175 Ga0070681_10000035
176 Ga0068867_101042434
177 Ga0070706_100000183
178 Ga0070706_100000615
179 Ga0070706_100001134
180 Ga0070706_100102182
181 Ga0070706_100284812
182 Ga0070706_101419437
183 Ga0070707_100000098
184 Ga0070707_100000741
185 Ga0070698_100053048
186 Ga0070698_100114035
187 Ga0070698_100375927
188 Ga0070698_101560554
189 Ga0070699_100064742
190 Ga0070699_100301665
191 Ga0070699_100780167
192 Ga0070699_101164909
193 Ga0070679_100000072
194 Ga0070697_100000200
195 Ga0068853_101733919
196 Ga0070672_100576835
197 Ga0070695_100284538
198 Ga0070696_100216587
199 Ga0070704_100005083
200 Ga0070704_100053469
201 Ga0068857_100875178
202 Ga0068857_100960809
203 Ga0068852_101467592
204 Ga0068859_100000128
205 Ga0068859_100001059
206 Ga0068859_100142244
207 Ga0068859_100572126
208 Ga0068864_101913367
209 Ga0068866_10229402
210 Ga0068861_100281917
211 Ga0068870_10007235
212 Ga0068863_100012038
213 Ga0068858_100159288
214 Ga0068858_100842084
215 Ga0068860_100118181
216 Ga0068860_100126018
217 Ga0068860_100519654
218 Ga0068860_100831661
219 Ga0068860_101203953
220 Ga0068862_100852405
221 Ga0081539_10006824
222 Ga0070716_100155996
223 Ga0068865_100478174
224 Ga0075436_100000157
225 Ga0097620_100000079
226 Ga0097620_100000128
227 Ga0097620_100000395
228 Ga0097620_100001059
229 Ga0097620_100142241
230 Ga0097620_100572084
231 Ga0075435_100001515
232 Ga0075435_101528193
233 Ga0105247_10232115
234 Ga0105247_10234108
235 Ga0114129_10975366
236 Ga0114129_11563396
237 Ga0114129_12131175
238 Ga0105243_10378242
239 Ga0105241_10788434
240 Ga0105248_10000922
241 Ga0105248_10015426
242 Ga0157373_10545840
243 Ga0157378_12150134
244 Ga0163163_10374556
245 Ga0207653_10000072
246 Ga0207653_10029609
247 Ga0207710_10000335
248 Ga0207643_10003401
249 Ga0207684_10000175
250 Ga0207684_10003213
251 Ga0207684_10006490
252 Ga0207684_10067614
253 Ga0207684_11491831
254 Ga0207707_10000017
255 Ga0207660_11023665
256 Ga0207652_10000120
257 Ga0207646_10000081
258 Ga0207646_10002102
259 Ga0207681_10016165
260 Ga0207694_10042004
261 Ga0207650_10173656
262 Ga0207644_10002894
263 Ga0207706_10523369
264 Ga0207686_10000024
265 Ga0207709_10000012
266 Ga0207670_10000495
267 Ga0207670_10000830
268 Ga0207665_10130832
269 Ga0207711_10001148
270 Ga0207711_10718857
271 Ga0207689_10347761
272 Ga0207689_11036185
273 Ga0207651_11173860
274 Ga0207639_11156417
275 Ga0207708_10003603
276 Ga0207708_11795324
277 Ga0207702_11210487
278 Ga0207641_10004437
279 Ga0207641_10558882
280 Ga0207648_10781075
281 Ga0207676_10010788
282 Ga0207675_100071975
283 Ga0207675_100122296
284 Ga0207675_100313372
285 Ga0207698_10289112
286 Ga0207698_11523744
287 Ga0268264_10091365
288 Ga0268264_10167204
289 Ga0268264_10768213
290 Ga0307513_10324573
291 Ga0307414_10598332
292 Ga0453683_0265432
293 nmdc:mga0rr50_2441_c1
294 nmdc:mga08x19_205_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map