F200173

General Info

Members Datasets Scaffolds Average Seq Length
147 100 145 229

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001479|Ga0105240_1000147924
Length 254
Sequence MNERTPAKPSQEFQIMKEKKNTILVVDDEEQIRKMLNIFLDTADFKVVESENCKQAIRMIASVKPDLVILDLGLPDMDGKEAIKAVREWTQVPIIVLSVRSDDDEIVMALNLGADDYVTKPFGAEVLLARINANLRKWAVREAGEPMIVNGPIKMDLVRHEVFINDEKISFTPKEYDLLRYFITNRGRMLTHKQILKQVWGPAHVEDTQYLRVYIGQVREKLEKVPGLGKLIVAESGIGYRMDIADGNTSIEAA

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
26 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
27 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
28 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
29 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
39 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
45 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
46 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
47 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
48 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
49 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
50 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
51 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
64 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
65 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
66 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
67 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
68 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
69 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
70 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
71 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
72 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
73 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
81 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
86 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
87 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
88 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
89 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
90 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
91 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
92 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
93 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
94 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
95 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
96 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
97 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
98 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.28
Metatranscriptomes 1.36
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.12
Nodule 0
Rhizoplane 5.44
Rhizosphere 72.11
Stem 0
Stem Tuber 0
Unclassified 16.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10108993 3300003316 Bacteria 2046
2 rootH2_10161230 3300003320 Bacteria 3932
3 rootH1_10094165 3300003323 Bacteria 8788
4 Ga0070670_100000097 3300005331 Bacteria 81485
5 Ga0070670_100027471 3300005331 Bacteria 4895
6 Ga0070668_100078554 3300005347 Bacteria 2581
7 Ga0070698_100044726 3300005471 Bacteria 4531
8 Ga0070699_100013082 3300005518 Bacteria 7150
9 Ga0070697_100619853 3300005536 Bacteria 952
10 Ga0070695_100027547 3300005545 Bacteria 3521
11 Ga0070704_100105398 3300005549 Bacteria 2134
12 Ga0068855_100009274 3300005563 Bacteria 11887
13 Ga0068856_100217823 3300005614 Bacteria 1924
14 Ga0068860_100000023 3300005843 Bacteria 279076
15 Ga0081455_10078752 3300005937 Bacteria 2708
16 Ga0081455_10114062 3300005937 Bacteria 2142
17 Ga0081540_1000210 3300005983 Bacteria 61367
18 Ga0081539_10000773 3300005985 Bacteria 62951
19 Ga0075365_10019520 3300006038 Bacteria 4185
20 Ga0070716_100016440 3300006173 Bacteria 3819
21 Ga0105240_10001396 3300009093 Bacteria 41509
22 Ga0105240_10001479 3300009093 Bacteria 40011
23 Ga0114129_10005535 3300009147 Bacteria 17866
24 Ga0114129_10695772 3300009147 Bacteria 1307
25 Ga0105243_10020884 3300009148 Bacteria 4969
26 Ga0105243_10034240 3300009148 Bacteria 3930
27 Ga0157370_10136793 3300013104 Bacteria 2283
28 Ga0183365_10001 3300015684 Bacteria 2090444
29 Ga0213874_10000776 3300021377 Bacteria 6481
30 Ga0213876_10010691 3300021384 Bacteria 4916
31 Ga0213876_10228792 3300021384 Bacteria 988
32 Ga0213875_10016474 3300021388 Bacteria 3582
33 Ga0213875_10114058 3300021388 Bacteria 1262
34 Ga0207688_10434143 3300025901 Bacteria 817
35 Ga0207695_10001275 3300025913 Bacteria 42870
36 Ga0207695_10001455 3300025913 Bacteria 39644
37 Ga0207650_10018388 3300025925 Bacteria 4905
38 Ga0207706_10348709 3300025933 Bacteria 1287
39 Ga0207665_10045426 3300025939 Bacteria 2941
40 Ga0207667_10008917 3300025949 Bacteria 11866
41 Ga0207702_10622266 3300026078 Bacteria 1060
42 Ga0207698_10461258 3300026142 Bacteria 1229
43 Ga0268264_10000008 3300028381 Bacteria 773387
44 Ga0265324_10053211 3300029957 Bacteria 1390
45 Ga0265316_10324920 3300031344 Bacteria 1117
46 Ga0265314_10106026 3300031711 Bacteria 1796
47 Ga0265314_10261861 3300031711 Unclassified 987
48 Ga0373936_0058662 3300035113 Bacteria 1567
49 Ga0395898_0557643 3300037466 Bacteria 1088
50 Ga0395905_0000174 3300037471 Bacteria 104301
51 Ga0395905_0030752 3300037471 Bacteria 5057
52 Ga0395905_0070830 3300037471 Bacteria 3268
53 Ga0436364_0050370 3300037853 Bacteria 2462
54 Ga0436364_0461382 3300037853 Bacteria 16125
55 Ga0436364_0648614 3300037853 Bacteria 1871
56 Ga0436364_1035783 3300037853 Bacteria 6369
57 Ga0400483_122822 3300039062 Bacteria 3257
58 Ga0400489_34291 3300039093 Bacteria 2913
59 Ga0436365_0123204 3300039437 Bacteria 2981
60 Ga0436365_0540768 3300039437 Bacteria 3243
61 Ga0436365_0551613 3300039437 Bacteria 1348
62 Ga0436365_0774382 3300039437 Bacteria 14945
63 Ga0436365_1388867 3300039437 Bacteria 3663
64 Ga0436365_1917722 3300039437 Bacteria 2760
65 Ga0436363_1105470 3300039450 Bacteria 15045
66 Ga0436362_0078642 3300039453 Bacteria 3866
67 Ga0436362_0182172 3300039453 Bacteria 2702
68 Ga0451577_0048713 3300042876 Bacteria 3784
69 Ga0466969_0001576 3300044656 Bacteria 12202
70 Ga0466969_0024684 3300044656 Bacteria 3092
71 Ga0466966_0001599 3300044684 Bacteria 14568
72 Ga0466966_0006176 3300044684 Bacteria 7919
73 Ga0466961_0003339 3300044693 Bacteria 10017
74 Ga0466961_0025857 3300044693 Bacteria 3773
75 Ga0466961_0251896 3300044693 Bacteria 1084
76 Ga0466963_0093187 3300044694 Bacteria 2053
77 Ga0466963_0124088 3300044694 Bacteria 1779
78 Ga0466963_0241557 3300044694 Bacteria 1266
79 Ga0453684_0000415 3300044712 Bacteria 174067
80 Ga0453684_0000420 3300044712 Bacteria 172995
81 Ga0453684_0011683 3300044712 Bacteria 14649
82 Ga0453684_0017056 3300044712 Bacteria 11275
83 Ga0453684_0024454 3300044712 Bacteria 8827
84 Ga0453684_0081867 3300044712 Unclassified 4024
85 Ga0453684_0126933 3300044712 Bacteria 3068
86 Ga0466971_0004129 3300044719 Bacteria 6255
87 Ga0466971_0005604 3300044719 Bacteria 5459
88 Ga0466971_0007570 3300044719 Bacteria 4735
89 Ga0466970_0015257 3300044765 Bacteria 3950
90 Ga0466970_0021013 3300044765 Bacteria 3398
91 Ga0466957_0006311 3300044842 Bacteria 6686
92 Ga0466957_0050934 3300044842 Bacteria 2520
93 Ga0466957_0285038 3300044842 Bacteria 1106
94 Ga0466959_0000103 3300045049 Bacteria 54729
95 Ga0466959_0000300 3300045049 Bacteria 29361
96 Ga0466959_0015998 3300045049 Bacteria 5474
97 Ga0466959_0208075 3300045049 Bacteria 1360
98 Ga0451576_0195982 3300045051 Bacteria 2110
99 Ga0451576_0447283 3300045051 Bacteria 1356
100 Ga0466958_0004178 3300045836 Bacteria 7587
101 Ga0466958_0007794 3300045836 Bacteria 5910
102 Ga0466958_0037495 3300045836 Bacteria 2904
103 Ga0466958_0224647 3300045836 Bacteria 1198
104 Ga0466967_0159760 3300045976 Bacteria 2114
105 Ga0466967_0863101 3300045976 Bacteria 900
106 Ga0495618_0139497 3300046514 Bacteria 1551
107 Ga0495634_0000381 3300046642 Bacteria 43342
108 Ga0495635_0105541 3300046663 Bacteria 1925
109 Ga0495646_0168980 3300046680 Bacteria 1206
110 Ga0496100_0003431 3300048903 Bacteria 8265
111 Ga0496101_0017264 3300048904 Bacteria 4893
112 Ga0496103_0085712 3300048906 Bacteria 1985
113 Ga0496104_0000307 3300048907 Bacteria 43626
114 Ga0496105_0000070 3300048908 Bacteria 80117
115 Ga0496106_0014368 3300048909 Bacteria 5850
116 Ga0496107_0004108 3300048910 Bacteria 9808
117 Ga0496115_0476558 3300048918 Bacteria 1005
118 Ga0501033_0330727 3300049570 Bacteria 1069
119 Ga0501034_0009443 3300049571 Bacteria 10207
120 Ga0501038_0029456 3300049574 Bacteria 4864
121 Ga0501046_0577261 3300049580 Bacteria 799
122 Ga0501047_0008310 3300049581 Bacteria 9796
123 Ga0501070_0291464 3300049586 Bacteria 1330
124 Ga0501076_0415469 3300049592 Unclassified 1107
125 Ga0501079_0780462 3300049741 Bacteria 752
126 Ga0501083_0391590 3300049744 Bacteria 904
127 Ga0501035_0028426 3300049822 Bacteria 5103
128 Ga0501044_0093113 3300049823 Bacteria 3039
129 nmdc:mga03n38_283007_c1 3300050490 Bacteria 886
130 nmdc:mga05p37_19856_c1 3300050507 Bacteria 8130
131 nmdc:mga09592_10404_c1 3300050508 Bacteria 7570
132 nmdc:mga0a205_366_c1 3300050515 Bacteria 34091
133 Ga0495601_0007744 3300053077 Bacteria 6314
134 Ga0500556_0000934 3300053104 Bacteria 15796
135 Ga0500562_002521 3300053108 Bacteria 4574
136 Ga0500595_018704 3300053119 Bacteria 2529
137 Ga0500597_016961 3300053120 Bacteria 2791
138 Ga0500608_038247 3300053122 Bacteria 2294
139 Ga0500618_004522 3300053125 Bacteria 4408
140 Ga0500636_0105211 3300053177 Bacteria 1600
141 Ga0587079_074642 3300059647 Bacteria 763
142 Ga0587071_061151 3300060344 Bacteria 801
143 Ga0466962_0001406 3300061719 Bacteria 11200
144 Ga0466962_0009940 3300061719 Bacteria 4565
145 Ga0466962_0032737 3300061719 Bacteria 2488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021388 Ga0213875_10114058 Ga0213875_101140582 206
2 3300037853 Ga0436364_0461382 Ga0436364_0461382_995_1681 206
3 3300039437 Ga0436365_1388867 Ga0436365_1388867_531_1217 206
4 3300039062 Ga0400483_122822 Ga0400483_122822_13_642 207
5 3300049592 Ga0501076_0415469 Ga0501076_0415469_28_666 211
6 3300003323 rootH1_10094165 rootH1_100941659 212
7 3300046663 Ga0495635_0105541 Ga0495635_0105541_207_890 218
8 3300037853 Ga0436364_0050370 Ga0436364_0050370_188_850 220
9 3300039437 Ga0436365_0123204 Ga0436365_0123204_428_1090 220
10 3300039453 Ga0436362_0182172 Ga0436362_0182172_1126_1788 220
11 3300044656 Ga0466969_0001576 Ga0466969_0001576_7574_8293 220
12 3300044684 Ga0466966_0006176 Ga0466966_0006176_1235_1954 220
13 3300044693 Ga0466961_0003339 Ga0466961_0003339_4477_5196 220
14 3300044694 Ga0466963_0093187 Ga0466963_0093187_195_914 220
15 3300044719 Ga0466971_0004129 Ga0466971_0004129_201_920 220
16 3300044765 Ga0466970_0015257 Ga0466970_0015257_441_1160 220
17 3300044842 Ga0466957_0285038 Ga0466957_0285038_190_909 220
18 3300045049 Ga0466959_0000300 Ga0466959_0000300_17827_18546 220
19 3300045836 Ga0466958_0037495 Ga0466958_0037495_1611_2330 220
20 3300061719 Ga0466962_0001406 Ga0466962_0001406_593_1312 220
21 3300049580 Ga0501046_0577261 Ga0501046_0577261_119_784 221
22 3300053119 Ga0500595_018704 Ga0500595_018704_778_1509 221
23 3300039093 Ga0400489_34291 Ga0400489_34291_675_1355 222
24 3300049741 Ga0501079_0780462 Ga0501079_0780462_68_739 222
25 3300053104 Ga0500556_0000934 Ga0500556_0000934_1060_1734 222
26 3300053122 Ga0500608_038247 Ga0500608_038247_623_1378 222
27 iso_pu_bacteria 2524023250 2524613890 222
28 3300046680 Ga0495646_0168980 Ga0495646_0168980_192_881 224
29 3300048903 Ga0496100_0003431 Ga0496100_0003431_1321_1995 224
30 3300048904 Ga0496101_0017264 Ga0496101_0017264_1025_1699 224
31 3300048906 Ga0496103_0085712 Ga0496103_0085712_403_1077 224
32 3300048909 Ga0496106_0014368 Ga0496106_0014368_3645_4319 224
33 3300048910 Ga0496107_0004108 Ga0496107_0004108_5700_6374 224
34 3300048918 Ga0496115_0476558 Ga0496115_0476558_104_778 224
35 3300049571 Ga0501034_0009443 Ga0501034_0009443_902_1582 224
36 3300049574 Ga0501038_0029456 Ga0501038_0029456_1531_2211 224
37 3300049581 Ga0501047_0008310 Ga0501047_0008310_6631_7311 224
38 3300049586 Ga0501070_0291464 Ga0501070_0291464_636_1316 224
39 3300049744 Ga0501083_0391590 Ga0501083_0391590_187_867 224
40 3300049823 Ga0501044_0093113 Ga0501044_0093113_1141_1821 224
41 3300005983 Ga0081540_1000210 Ga0081540_100021070 225
42 3300006038 Ga0075365_10019520 Ga0075365_100195203 225
43 3300025901 Ga0207688_10434143 Ga0207688_104341432 225
44 3300037853 Ga0436364_0648614 Ga0436364_0648614_532_1209 225
45 3300050490 nmdc:mga03n38_283007_c1 nmdc:mga03n38_283007_c1_41_733 225
46 3300005937 Ga0081455_10078752 Ga0081455_100787524 226
47 3300005937 Ga0081455_10114062 Ga0081455_101140623 226
48 3300006173 Ga0070716_100016440 Ga0070716_1000164405 226
49 3300009147 Ga0114129_10695772 Ga0114129_106957722 226
50 3300021384 Ga0213876_10010691 Ga0213876_100106914 226
51 3300021384 Ga0213876_10228792 Ga0213876_102287922 226
52 3300021388 Ga0213875_10016474 Ga0213875_100164742 226
53 3300025939 Ga0207665_10045426 Ga0207665_100454265 226
54 3300035113 Ga0373936_0058662 Ga0373936_0058662_498_1178 226
55 3300037853 Ga0436364_1035783 Ga0436364_1035783_3705_4391 226
56 3300039437 Ga0436365_0551613 Ga0436365_0551613_176_856 226
57 3300039437 Ga0436365_0774382 Ga0436365_0774382_6796_7482 226
58 3300039453 Ga0436362_0078642 Ga0436362_0078642_1723_2406 226
59 3300044694 Ga0466963_0124088 Ga0466963_0124088_353_1033 226
60 3300044719 Ga0466971_0005604 Ga0466971_0005604_2033_2713 226
61 3300044842 Ga0466957_0050934 Ga0466957_0050934_1172_1852 226
62 3300045049 Ga0466959_0208075 Ga0466959_0208075_275_955 226
63 3300045836 Ga0466958_0224647 Ga0466958_0224647_363_1043 226
64 3300045976 Ga0466967_0159760 Ga0466967_0159760_142_822 226
65 3300046514 Ga0495618_0139497 Ga0495618_0139497_750_1430 226
66 3300046642 Ga0495634_0000381 Ga0495634_0000381_10257_10943 226
67 3300048907 Ga0496104_0000307 Ga0496104_0000307_4482_5162 226
68 3300048908 Ga0496105_0000070 Ga0496105_0000070_16110_16790 226
69 3300050515 nmdc:mga0a205_366_c1 nmdc:mga0a205_366_c1_17831_18517 226
70 3300053077 Ga0495601_0007744 Ga0495601_0007744_3310_3990 226
71 3300009148 Ga0105243_10020884 Ga0105243_100208841 227
72 3300021377 Ga0213874_10000776 Ga0213874_100007763 227
73 3300026142 Ga0207698_10461258 Ga0207698_104612582 227
74 3300039437 Ga0436365_1917722 Ga0436365_1917722_300_1010 227
75 3300039450 Ga0436363_1105470 Ga0436363_1105470_4051_4761 227
76 iso_pu_bacteria 2739367756 2739790821 227
77 3300044693 Ga0466961_0251896 Ga0466961_0251896_348_1070 228
78 3300045049 Ga0466959_0000103 Ga0466959_0000103_17051_17773 228
79 3300045836 Ga0466958_0004178 Ga0466958_0004178_3447_4169 228
80 3300013104 Ga0157370_10136793 Ga0157370_101367932 229
81 3300037466 Ga0395898_0557643 Ga0395898_0557643_70_759 229
82 3300005331 Ga0070670_100000097 Ga0070670_10000009751 230
83 3300005331 Ga0070670_100027471 Ga0070670_1000274712 230
84 3300005347 Ga0070668_100078554 Ga0070668_1000785542 230
85 3300005471 Ga0070698_100044726 Ga0070698_1000447264 230
86 3300005518 Ga0070699_100013082 Ga0070699_1000130825 230
87 3300005536 Ga0070697_100619853 Ga0070697_1006198531 230
88 3300005545 Ga0070695_100027547 Ga0070695_1000275472 230
89 3300005549 Ga0070704_100105398 Ga0070704_1001053982 230
90 3300005843 Ga0068860_100000023 Ga0068860_100000023107 230
91 3300005985 Ga0081539_10000773 Ga0081539_1000077312 230
92 3300009147 Ga0114129_10005535 Ga0114129_100055352 230
93 3300009148 Ga0105243_10034240 Ga0105243_100342404 230
94 3300025925 Ga0207650_10018388 Ga0207650_100183882 230
95 3300025933 Ga0207706_10348709 Ga0207706_103487092 230
96 3300028381 Ga0268264_10000008 Ga0268264_10000008152 230
97 3300039437 Ga0436365_0540768 Ga0436365_0540768_1019_1720 230
98 3300042876 Ga0451577_0048713 Ga0451577_0048713_865_1560 230
99 3300044712 Ga0453684_0000415 Ga0453684_0000415_45212_45907 230
100 3300044712 Ga0453684_0011683 Ga0453684_0011683_4114_4809 230
101 3300044712 Ga0453684_0017056 Ga0453684_0017056_1970_2665 230
102 3300044712 Ga0453684_0024454 Ga0453684_0024454_1537_2232 230
103 3300044712 Ga0453684_0081867 Ga0453684_0081867_1240_1935 230
104 3300044712 Ga0453684_0126933 Ga0453684_0126933_1896_2591 230
105 3300045051 Ga0451576_0195982 Ga0451576_0195982_969_1667 230
106 3300050507 nmdc:mga05p37_19856_c1 nmdc:mga05p37_19856_c1_5869_6564 230
107 3300050508 nmdc:mga09592_10404_c1 nmdc:mga09592_10404_c1_330_1025 230
108 3300053108 Ga0500562_002521 Ga0500562_002521_1819_2520 230
109 3300003316 rootH1_10108993 rootH1_101089932 231
110 3300003320 rootH2_10161230 rootH2_101612303 231
111 3300005563 Ga0068855_100009274 Ga0068855_10000927414 231
112 3300005614 Ga0068856_100217823 Ga0068856_1002178233 231
113 3300009093 Ga0105240_10001396 Ga0105240_1000139625 231
114 3300009093 Ga0105240_10001479 Ga0105240_1000147924 231
115 3300015684 Ga0183365_10001 Ga0183365_10001109 231
116 3300025913 Ga0207695_10001275 Ga0207695_1000127525 231
117 3300025913 Ga0207695_10001455 Ga0207695_1000145523 231
118 3300025949 Ga0207667_10008917 Ga0207667_100089175 231
119 3300026078 Ga0207702_10622266 Ga0207702_106222661 231
120 3300029957 Ga0265324_10053211 Ga0265324_100532112 231
121 3300031344 Ga0265316_10324920 Ga0265316_103249202 231
122 3300031711 Ga0265314_10106026 Ga0265314_101060262 231
123 3300031711 Ga0265314_10261861 Ga0265314_102618611 231
124 3300037471 Ga0395905_0000174 Ga0395905_0000174_101936_102631 231
125 3300037471 Ga0395905_0030752 Ga0395905_0030752_103_801 231
126 3300037471 Ga0395905_0070830 Ga0395905_0070830_255_971 231
127 3300044656 Ga0466969_0024684 Ga0466969_0024684_1140_1835 231
128 3300044684 Ga0466966_0001599 Ga0466966_0001599_973_1668 231
129 3300044693 Ga0466961_0025857 Ga0466961_0025857_973_1668 231
130 3300044694 Ga0466963_0241557 Ga0466963_0241557_173_868 231
131 3300044712 Ga0453684_0000420 Ga0453684_0000420_14826_15524 231
132 3300044719 Ga0466971_0007570 Ga0466971_0007570_2105_2800 231
133 3300044765 Ga0466970_0021013 Ga0466970_0021013_2026_2721 231
134 3300044842 Ga0466957_0006311 Ga0466957_0006311_3370_4065 231
135 3300045049 Ga0466959_0015998 Ga0466959_0015998_3113_3808 231
136 3300045051 Ga0451576_0447283 Ga0451576_0447283_370_1065 231
137 3300045836 Ga0466958_0007794 Ga0466958_0007794_3485_4180 231
138 3300045976 Ga0466967_0863101 Ga0466967_0863101_160_879 231
139 3300049570 Ga0501033_0330727 Ga0501033_0330727_216_911 231
140 3300049822 Ga0501035_0028426 Ga0501035_0028426_3862_4557 231
141 3300053120 Ga0500597_016961 Ga0500597_016961_42_752 231
142 3300053125 Ga0500618_004522 Ga0500618_004522_338_1063 231
143 3300053177 Ga0500636_0105211 Ga0500636_0105211_114_824 231
144 3300059647 Ga0587079_074642 Ga0587079_074642_58_753 231
145 3300060344 Ga0587071_061151 Ga0587071_061151_47_742 231
146 3300061719 Ga0466962_0009940 Ga0466962_0009940_1731_2426 231
147 3300061719 Ga0466962_0032737 Ga0466962_0032737_1512_2207 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

23

132

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9881 5 121
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9805 6 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9802 6 122
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9784 6 122
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9772 6 122
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 1.001 6 81 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9953 6 83 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9868 6 89 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9857 3 83 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9852 4 81 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2H0YKY1-F1-model_v4 Fis family transcriptional regulator 0.9737 5 127 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A7Y3E9I3-F1-model_v4 Response regulator 0.9725 6 125 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A836X728-F1-model_v4 Response regulator 0.9723 1 127 GO:0000160
GO:0003677
AF-A0A401IJC1-F1-model_v4 Diguanylate phosphodiesterase 0.972 5 126 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A257TBE7-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9717 5 122 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565

Feature Viewer

pLDDT pTM Quality
88.34 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map