F198732

General Info

Members Datasets Scaffolds Average Seq Length
146 113 292 302

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0044085|Ga0501046_0044085_1030_2109
Length 359
Sequence MDSSSELAAVLKFKKEALAGRQWLGTRARGIHSPSWGHAVSHRNLIYSARFVCLLGFVVEGMSAMRDPVMQTNLGNLPMRRGKVRDIYDLGDRLLLIASDRISAFDWILPTGIPDKGRVLTQISSFWFNRLHEPHHLLSTDIAHAGLPASFDIAPLAGRSMIVRKTEVVPIECVVRGYMSGSGWKEYQQSQSICGVALPAGLRESDKLPEPIFTPATKAESGHDMNISFEQMAEIVGRDVAEQLRRRSLAVYQRGAEFASGKGIIIADTKFEWGRVGDEFILIDEVLTPDSSRFWPADAYQPGGAQPSFDKQFVRDWLETTDWDKDSQPPELPLDVITRTREKYIEAYERLTGVAFGWK

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
53 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
59 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
60 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
61 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
62 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
69 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
70 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
71 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
72 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
73 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
74 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
75 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
76 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
77 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
78 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
104 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
105 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
106 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
109 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
110 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
111 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
112 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
113 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 1.37
Isolates 4.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 0
Rhizoplane 2.74
Rhizosphere 78.08
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0044085 3300049580 Bacteria 3548
2 Ga0070658_10222335 3300005327 Bacteria 1597
3 Ga0070683_100001411 3300005329 Bacteria 18434
4 Ga0070683_100042352 3300005329 Bacteria 4193
5 Ga0070680_100055328 3300005336 Bacteria 3242
6 Ga0070660_100141463 3300005339 Bacteria 1930
7 Ga0070714_100000129 3300005435 Bacteria 59328
8 Ga0070713_100365316 3300005436 Bacteria 1342
9 Ga0070708_100057256 3300005445 Bacteria 3470
10 Ga0070706_100341195 3300005467 Bacteria 1397
11 Ga0070707_100089906 3300005468 Bacteria 2972
12 Ga0070698_100132425 3300005471 Bacteria 2448
13 Ga0070699_100452665 3300005518 Bacteria 1164
14 Ga0068853_100017910 3300005539 Bacteria 5853
15 Ga0070665_100000550 3300005548 Bacteria 52403
16 Ga0068855_100198176 3300005563 Bacteria 2262
17 Ga0068855_100339978 3300005563 Bacteria 1655
18 Ga0070664_100477388 3300005564 Bacteria 1147
19 Ga0068857_100058574 3300005577 Bacteria 3421
20 Ga0068851_10034615 3300005834 Bacteria 2522
21 Ga0070717_10000777 3300006028 Bacteria 20908
22 Ga0075367_10187442 3300006178 Bacteria 1290
23 Ga0075428_100006144 3300006844 Bacteria 13368
24 Ga0075428_100022991 3300006844 Bacteria 6899
25 Ga0075431_100100031 3300006847 Bacteria 2992
26 Ga0099795_10031840 3300007788 Bacteria 1819
27 Ga0105240_10021826 3300009093 Bacteria 8508
28 Ga0105239_10020510 3300010375 Bacteria 7289
29 Ga0157370_10228664 3300013104 Bacteria 1722
30 Ga0157369_10027419 3300013105 Bacteria 6314
31 Ga0206350_11568282 3300020080 Bacteria 1629
32 Ga0207707_10008196 3300025912 Bacteria 9069
33 Ga0207671_10038834 3300025914 Bacteria 3528
34 Ga0207660_10004498 3300025917 Bacteria 9093
35 Ga0207657_10003811 3300025919 Bacteria 16033
36 Ga0207652_10005369 3300025921 Bacteria 10395
37 Ga0207646_10630593 3300025922 Bacteria 961
38 Ga0207694_10125424 3300025924 Bacteria 2053
39 Ga0207664_10000139 3300025929 Bacteria 60860
40 Ga0207690_10117302 3300025932 Bacteria 1927
41 Ga0207667_10019291 3300025949 Bacteria 7618
42 Ga0207639_10060237 3300026041 Bacteria 2928
43 Ga0207674_10010157 3300026116 Bacteria 10703
44 Ga0207675_100341962 3300026118 Bacteria 1465
45 Ga0207698_10208568 3300026142 Bacteria 1756
46 Ga0268266_10000253 3300028379 Bacteria 90293
47 Ga0265337_1001198 3300028556 Bacteria 13185
48 Ga0265337_1013843 3300028556 Bacteria 2692
49 Ga0265337_1015200 3300028556 Bacteria 2528
50 Ga0265319_1023402 3300028563 Bacteria 2240
51 Ga0265334_10000515 3300028573 Bacteria 19808
52 Ga0265336_10003916 3300028666 Bacteria 5706
53 Ga0265338_10002477 3300028800 Bacteria 27590
54 Ga0265338_10016574 3300028800 Bacteria 8000
55 Ga0265338_10034261 3300028800 Bacteria 4912
56 Ga0265338_10038952 3300028800 Bacteria 4494
57 Ga0265338_10075715 3300028800 Bacteria 2854
58 Ga0265338_10111550 3300028800 Bacteria 2201
59 Ga0265760_10002695 3300031090 Bacteria 5193
60 Ga0265320_10085717 3300031240 Bacteria 1466
61 Ga0265325_10000167 3300031241 Bacteria 46417
62 Ga0265325_10029288 3300031241 Bacteria 2960
63 Ga0265339_10001827 3300031249 Bacteria 15623
64 Ga0265339_10002098 3300031249 Bacteria 14552
65 Ga0265331_10004327 3300031250 Bacteria 8890
66 Ga0265327_10004609 3300031251 Bacteria 12115
67 Ga0265313_10000349 3300031595 Bacteria 50279
68 Ga0265314_10001874 3300031711 Bacteria 22550
69 Ga0265342_10032058 3300031712 Bacteria 3243
70 Ga0316576_10005463 3300031727 Bacteria 7771
71 Ga0316576_10028050 3300031727 Bacteria 3964
72 Ga0316576_10072586 3300031727 Bacteria 2541
73 Ga0307510_10059934 3300033180 Bacteria 3923
74 Ga0373926_0101538 3300035083 Bacteria 1076
75 Ga0373940_0042708 3300035088 Bacteria 1250
76 Ga0373932_0008552 3300035112 Bacteria 2448
77 Ga0316574_0022000 3300035398 Bacteria 3792
78 Ga0373931_0003186 3300035691 Bacteria 7320
79 Ga0373927_0002173 3300035695 Bacteria 14399
80 Ga0373947_0013387 3300035725 Bacteria 4702
81 Ga0373937_0631563 3300036401 Bacteria 1016
82 Ga0316582_0018464 3300036647 Bacteria 4060
83 Ga0316582_0052176 3300036647 Bacteria 2599
84 Ga0316582_0079669 3300036647 Bacteria 2136
85 Ga0316584_0329528 3300036712 Bacteria 1100
86 Ga0400484_31396 3300038725 Unclassified 3871
87 Ga0400490_29352 3300038726 Unclassified 1720
88 Ga0400490_32920 3300038726 Bacteria 3338
89 Ga0400490_54271 3300038726 Bacteria 2596
90 Ga0400491_17098 3300038727 Bacteria 2488
91 Ga0400485_15766 3300038735 Bacteria 11054
92 Ga0400488_02022 3300038741 Bacteria 11664
93 Ga0400488_14410 3300038741 Bacteria 2092
94 Ga0400486_15825 3300038742 Bacteria 110284
95 Ga0400486_18989 3300038742 Bacteria 6375
96 Ga0400483_100528 3300039062 Bacteria 7893
97 Ga0400483_167288 3300039062 Bacteria 36843
98 Ga0400483_231789 3300039062 Bacteria 6215
99 Ga0400489_56212 3300039093 Bacteria 13464
100 Ga0400487_14072 3300039110 Bacteria 3724
101 Ga0436361_0474908 3300039447 Bacteria 2216
102 Ga0436363_1276669 3300039450 Unclassified 1797
103 Ga0451855_1033630 3300041511 Bacteria 1471
104 Ga0451576_0290377 3300045051 Bacteria 1710
105 Ga0495603_0006899 3300046455 Bacteria 6817
106 Ga0495603_0058619 3300046455 Bacteria 2276
107 Ga0495580_0040646 3300046472 Bacteria 3321
108 Ga0495602_0049179 3300048088 Bacteria 3780
109 Ga0496104_0246530 3300048907 Bacteria 1699
110 Ga0496112_0204821 3300048915 Bacteria 1931
111 Ga0496113_0276377 3300048916 Bacteria 1343
112 Ga0496115_0051376 3300048918 Bacteria 3306
113 Ga0496125_0014665 3300048928 Bacteria 7617
114 Ga0496126_0281490 3300048929 Bacteria 1377
115 Ga0501034_0001697 3300049571 Bacteria 28390
116 Ga0501034_0002378 3300049571 Bacteria 22852
117 Ga0501034_0036055 3300049571 Bacteria 5014
118 Ga0501034_0062689 3300049571 Bacteria 3734
119 Ga0501034_0307987 3300049571 Bacteria 1519
120 Ga0501036_0142404 3300049572 Bacteria 2023
121 Ga0501038_0400301 3300049574 Bacteria 1062
122 Ga0501043_0007029 3300049579 Bacteria 8958
123 Ga0501047_0041110 3300049581 Bacteria 4468
124 Ga0501047_0050579 3300049581 Bacteria 4013
125 Ga0501048_0047679 3300049582 Bacteria 3057
126 Ga0501070_0001785 3300049586 Bacteria 18998
127 Ga0501070_0032418 3300049586 Bacteria 4373
128 Ga0501070_0175100 3300049586 Bacteria 1767
129 Ga0501076_0035499 3300049592 Bacteria 3901
130 Ga0501044_0021376 3300049823 Bacteria 6905
131 Ga0501044_0021934 3300049823 Bacteria 6809
132 Ga0501044_0124244 3300049823 Bacteria 2578
133 Ga0501045_0089178 3300049824 Bacteria 2278
134 Ga0501045_0212612 3300049824 Bacteria 1441
135 nmdc:mga08y16_323451_c1 3300050511 Bacteria 1587
136 Ga0495619_0065511 3300053085 Bacteria 2424
137 Ga0500554_000956 3300053102 Bacteria 5608
138 Ga0500603_000316 3300053150 Bacteria 12695
139 Ga0500637_0000360 3300053178 Bacteria 17211
140 Ga0501084_0389023 3300054114 Bacteria 1178
141 2687236706 2684623219 Bacteria 8442773
142 2688067280 2687453257 Bacteria 6784659
143 2688395456 2687453341 Bacteria 6534136
144 2836164196 2836160341 Unclassified 5867367
145 2889420964 2889415604 Bacteria 8048700
146 2920110196 2920107658 Bacteria 10042636
147 Ga0501046_0044085
148 Ga0070658_10222335
149 Ga0070683_100001411
150 Ga0070683_100042352
151 Ga0070680_100055328
152 Ga0070660_100141463
153 Ga0070714_100000129
154 Ga0070713_100365316
155 Ga0070708_100057256
156 Ga0070706_100341195
157 Ga0070707_100089906
158 Ga0070698_100132425
159 Ga0070699_100452665
160 Ga0068853_100017910
161 Ga0070665_100000550
162 Ga0068855_100198176
163 Ga0068855_100339978
164 Ga0070664_100477388
165 Ga0068857_100058574
166 Ga0068851_10034615
167 Ga0070717_10000777
168 Ga0075367_10187442
169 Ga0075428_100006144
170 Ga0075428_100022991
171 Ga0075431_100100031
172 Ga0099795_10031840
173 Ga0105240_10021826
174 Ga0105239_10020510
175 Ga0157370_10228664
176 Ga0157369_10027419
177 Ga0206350_11568282
178 Ga0207707_10008196
179 Ga0207671_10038834
180 Ga0207660_10004498
181 Ga0207657_10003811
182 Ga0207652_10005369
183 Ga0207646_10630593
184 Ga0207694_10125424
185 Ga0207664_10000139
186 Ga0207690_10117302
187 Ga0207667_10019291
188 Ga0207639_10060237
189 Ga0207674_10010157
190 Ga0207675_100341962
191 Ga0207698_10208568
192 Ga0268266_10000253
193 Ga0265337_1001198
194 Ga0265337_1013843
195 Ga0265337_1015200
196 Ga0265319_1023402
197 Ga0265334_10000515
198 Ga0265336_10003916
199 Ga0265338_10002477
200 Ga0265338_10016574
201 Ga0265338_10034261
202 Ga0265338_10038952
203 Ga0265338_10075715
204 Ga0265338_10111550
205 Ga0265760_10002695
206 Ga0265320_10085717
207 Ga0265325_10000167
208 Ga0265325_10029288
209 Ga0265339_10001827
210 Ga0265339_10002098
211 Ga0265331_10004327
212 Ga0265327_10004609
213 Ga0265313_10000349
214 Ga0265314_10001874
215 Ga0265342_10032058
216 Ga0316576_10005463
217 Ga0316576_10028050
218 Ga0316576_10072586
219 Ga0307510_10059934
220 Ga0373926_0101538
221 Ga0373940_0042708
222 Ga0373932_0008552
223 Ga0316574_0022000
224 Ga0373931_0003186
225 Ga0373927_0002173
226 Ga0373947_0013387
227 Ga0373937_0631563
228 Ga0316582_0018464
229 Ga0316582_0052176
230 Ga0316582_0079669
231 Ga0316584_0329528
232 Ga0400484_31396
233 Ga0400490_29352
234 Ga0400490_32920
235 Ga0400490_54271
236 Ga0400491_17098
237 Ga0400485_15766
238 Ga0400488_02022
239 Ga0400488_14410
240 Ga0400486_15825
241 Ga0400486_18989
242 Ga0400483_100528
243 Ga0400483_167288
244 Ga0400483_231789
245 Ga0400489_56212
246 Ga0400487_14072
247 Ga0436361_0474908
248 Ga0436363_1276669
249 Ga0451855_1033630
250 Ga0451576_0290377
251 Ga0495603_0006899
252 Ga0495603_0058619
253 Ga0495580_0040646
254 Ga0495602_0049179
255 Ga0496104_0246530
256 Ga0496112_0204821
257 Ga0496113_0276377
258 Ga0496115_0051376
259 Ga0496125_0014665
260 Ga0496126_0281490
261 Ga0501034_0001697
262 Ga0501034_0002378
263 Ga0501034_0036055
264 Ga0501034_0062689
265 Ga0501034_0307987
266 Ga0501036_0142404
267 Ga0501038_0400301
268 Ga0501043_0007029
269 Ga0501047_0041110
270 Ga0501047_0050579
271 Ga0501048_0047679
272 Ga0501070_0001785
273 Ga0501070_0032418
274 Ga0501070_0175100
275 Ga0501076_0035499
276 Ga0501044_0021376
277 Ga0501044_0021934
278 Ga0501044_0124244
279 Ga0501045_0089178
280 Ga0501045_0212612
281 nmdc:mga08y16_323451_c1
282 Ga0495619_0065511
283 Ga0500554_000956
284 Ga0500603_000316
285 Ga0500637_0000360
286 Ga0501084_0389023
287 2687236706
288 2688067280
289 2688395456
290 2836164196
291 2889420964
292 2920110196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

78

330

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9331 5 293
1obg-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9235 5 294
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9146 5 293
2cnv-assembly1.cif.gz_A saicar-synthase from saccharomyces cerevisiae complexed saicar 0.9136 5 294
1obg-assembly1.cif.gz_A saicar-synthase complexed with atp 0.9086 5 294
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9822 105 246 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9569 105 246 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9556 105 246 3.30.470.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9428 107 239 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9254 105 246 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A4P5YTB8-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9929 1 294 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A7V4IFP6-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9922 2 294 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A521XEA7-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9919 183 294 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A351RS94-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9915 174 290 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A533SKJ6-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9913 110 290 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Map