F198600

General Info

Members Datasets Scaffolds Average Seq Length
146 110 146 92

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0138635|Ga0496110_0138635_1130_1429
Length 99
Sequence MRRTLPRLLATLFTSCLVLALAAPASFATILSGGTDGGQGTYGEADDKVVTKAGFILIAFFPLLVFSLSMLQWRLEKRKDARKAAAKHRLSSADWHGGW

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
31 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
43 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
44 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.75
Rhizosphere 81.51
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10083413 3300003373 Bacteria 793
2 Ga0068868_100257664 3300005338 Bacteria 1470
3 Ga0068868_100651530 3300005338 Bacteria 938
4 Ga0070659_101022216 3300005366 Bacteria 726
5 Ga0070659_101996149 3300005366 Bacteria 521
6 Ga0070709_10733195 3300005434 Bacteria 771
7 Ga0070700_100795690 3300005441 Bacteria 761
8 Ga0070708_101168786 3300005445 Bacteria 720
9 Ga0070706_101399065 3300005467 Bacteria 640
10 Ga0070707_100294603 3300005468 Bacteria 1577
11 Ga0070693_100184475 3300005547 Bacteria 1345
12 Ga0068856_100801348 3300005614 Bacteria 962
13 Ga0070702_100123099 3300005615 Bacteria 1626
14 Ga0068864_100578896 3300005618 Bacteria 1088
15 Ga0068851_10212797 3300005834 Bacteria 1083
16 Ga0081538_10000905 3300005981 Bacteria 32057
17 Ga0081540_1002040 3300005983 Bacteria 16845
18 Ga0081540_1052469 3300005983 Bacteria 2007
19 Ga0081539_10003284 3300005985 Bacteria 20268
20 Ga0070712_101052953 3300006175 Bacteria 705
21 Ga0068871_101817018 3300006358 Bacteria 579
22 Ga0075431_100352191 3300006847 Bacteria 1480
23 Ga0068865_102160657 3300006881 Bacteria 506
24 Ga0105245_10348213 3300009098 Bacteria 1467
25 Ga0105245_10637208 3300009098 Bacteria 1095
26 Ga0105243_11091388 3300009148 Bacteria 806
27 Ga0105242_11839239 3300009176 Bacteria 645
28 Ga0105249_10934732 3300009553 Unclassified 935
29 Ga0105249_11813110 3300009553 Bacteria 683
30 Ga0105239_10285047 3300010375 Bacteria 1860
31 Ga0157323_1040621 3300012495 Bacteria 532
32 Ga0163162_10882877 3300013306 Bacteria 1008
33 Ga0157372_10455512 3300013307 Bacteria 1491
34 Ga0182008_10318739 3300014497 Bacteria 817
35 Ga0157377_10061642 3300014745 Bacteria 2144
36 Ga0207656_10143961 3300025321 Bacteria 1125
37 Ga0207653_10090751 3300025885 Bacteria 1070
38 Ga0207690_10863678 3300025932 Bacteria 749
39 Ga0207690_11166117 3300025932 Bacteria 643
40 Ga0207686_10880259 3300025934 Bacteria 722
41 Ga0207689_10281344 3300025942 Bacteria 1377
42 Ga0207679_10292515 3300025945 Bacteria 1401
43 Ga0207712_10436196 3300025961 Bacteria 1108
44 Ga0207640_10953691 3300025981 Bacteria 752
45 Ga0207640_12101588 3300025981 Bacteria 512
46 Ga0207677_10495413 3300026023 Bacteria 1055
47 Ga0207708_10819662 3300026075 Bacteria 802
48 Ga0207676_10562932 3300026095 Bacteria 1090
49 Ga0265337_1001587 3300028556 Bacteria 11114
50 Ga0265326_10035985 3300028558 Bacteria 1407
51 Ga0265319_1000144 3300028563 Bacteria 52606
52 Ga0265318_10003597 3300028577 Bacteria 7752
53 Ga0265322_10003919 3300028654 Bacteria 4461
54 Ga0265336_10000002 3300028666 Bacteria 830172
55 Ga0265338_10000001 3300028800 Bacteria 1177449
56 Ga0265324_10022189 3300029957 Bacteria 2271
57 Ga0265340_10000001 3300031247 Bacteria 1647668
58 Ga0265339_10090903 3300031249 Bacteria 1600
59 Ga0265316_10052429 3300031344 Bacteria 3200
60 Ga0307408_100056816 3300031548 Bacteria 2839
61 Ga0265342_10067445 3300031712 Bacteria 2093
62 Ga0307405_10071113 3300031731 Bacteria 2237
63 Ga0307405_11262844 3300031731 Bacteria 641
64 Ga0307413_10013868 3300031824 Bacteria 4072
65 Ga0307410_10009712 3300031852 Bacteria 5411
66 Ga0307410_10801227 3300031852 Bacteria 801
67 Ga0307406_10200800 3300031901 Bacteria 1467
68 Ga0307406_10219285 3300031901 Bacteria 1413
69 Ga0307406_11358676 3300031901 Unclassified 622
70 Ga0307407_10030889 3300031903 Bacteria 2895
71 Ga0307407_10509603 3300031903 Bacteria 883
72 Ga0307407_11393896 3300031903 Bacteria 552
73 Ga0307412_10074026 3300031911 Bacteria 2333
74 Ga0307409_100545231 3300031995 Bacteria 1137
75 Ga0307409_100586503 3300031995 Bacteria 1100
76 Ga0307409_101570186 3300031995 Unclassified 686
77 Ga0307416_100011415 3300032002 Bacteria 5923
78 Ga0307416_102706192 3300032002 Bacteria 593
79 Ga0307414_10253485 3300032004 Bacteria 1464
80 Ga0307411_10862871 3300032005 Bacteria 802
81 Ga0307415_100238429 3300032126 Bacteria 1469
82 Ga0373943_0172146 3300035170 Bacteria 1185
83 Ga0373946_0219875 3300035171 Bacteria 917
84 Ga0373947_0107469 3300035725 Bacteria 1759
85 Ga0373925_0344503 3300037068 Bacteria 1209
86 Ga0395898_0397298 3300037466 Bacteria 1314
87 Ga0395901_0676092 3300038443 Bacteria 1033
88 Ga0436365_1160061 3300039437 Unclassified 704
89 Ga0451789_0795627 3300041443 Unclassified 716
90 Ga0451853_2559687 3300041512 Bacteria 522
91 Ga0466972_0179146 3300044658 Bacteria 994
92 Ga0466965_0132148 3300044683 Bacteria 1295
93 Ga0466963_0229193 3300044694 Bacteria 1302
94 Ga0466963_0288636 3300044694 Bacteria 1153
95 Ga0466963_0730702 3300044694 Bacteria 698
96 Ga0466964_0201674 3300044706 Bacteria 955
97 Ga0466964_0281286 3300044706 Bacteria 832
98 Ga0466964_0459196 3300044706 Unclassified 677
99 Ga0466968_0697044 3300044735 Bacteria 518
100 Ga0466957_0942693 3300044842 Bacteria 618
101 Ga0466960_0283069 3300044901 Bacteria 930
102 Ga0466958_1139659 3300045836 Bacteria 509
103 Ga0466967_0006417 3300045976 Bacteria 8318
104 Ga0466967_0185827 3300045976 Bacteria 1962
105 Ga0466967_0278168 3300045976 Bacteria 1605
106 Ga0466967_0377786 3300045976 Bacteria 1375
107 Ga0466967_0439903 3300045976 Bacteria 1273
108 Ga0466967_1103284 3300045976 Bacteria 791
109 Ga0466967_1279721 3300045976 Unclassified 730
110 Ga0466967_1961100 3300045976 Bacteria 582
111 Ga0466967_2013297 3300045976 Bacteria 574
112 Ga0495641_0047417 3300046461 Bacteria 1972
113 Ga0495582_0210823 3300046473 Bacteria 1110
114 Ga0495658_0567192 3300046683 Bacteria 727
115 Ga0495624_0572368 3300046690 Bacteria 674
116 Ga0495676_0204279 3300047321 Bacteria 1371
117 Ga0495615_0203689 3300048090 Unclassified 612
118 Ga0496100_1244703 3300048903 Bacteria 587
119 Ga0496101_0368147 3300048904 Bacteria 1130
120 Ga0496101_1572294 3300048904 Bacteria 511
121 Ga0496102_0027563 3300048905 Bacteria 5073
122 Ga0496102_0380318 3300048905 Bacteria 1329
123 Ga0496104_0003357 3300048907 Bacteria 13829
124 Ga0496105_0014719 3300048908 Bacteria 6228
125 Ga0496106_0439302 3300048909 Bacteria 1048
126 Ga0496107_0161409 3300048910 Bacteria 1661
127 Ga0496108_0004537 3300048911 Bacteria 11182
128 Ga0496108_0090095 3300048911 Bacteria 2607
129 Ga0496109_0002702 3300048912 Bacteria 14874
130 Ga0496109_0307601 3300048912 Bacteria 1495
131 Ga0496110_0005789 3300048913 Bacteria 9716
132 Ga0496110_0138635 3300048913 Bacteria 2199
133 Ga0496110_0335595 3300048913 Bacteria 1377
134 Ga0496111_0004616 3300048914 Bacteria 8717
135 Ga0496112_0045614 3300048915 Bacteria 4297
136 Ga0496113_0017764 3300048916 Bacteria 4945
137 Ga0496114_0973009 3300048917 Bacteria 731
138 Ga0496115_0000121 3300048918 Bacteria 71105
139 Ga0496115_0277191 3300048918 Bacteria 1377
140 Ga0496121_0002122 3300048924 Bacteria 31152
141 Ga0496126_0679970 3300048929 Bacteria 802
142 Ga0501069_0015817 3300049585 Bacteria 4045
143 Ga0501069_0798997 3300049585 Bacteria 572
144 Ga0501074_0037822 3300049590 Bacteria 3497
145 Ga0501079_0333419 3300049741 Bacteria 1188
146 Ga0501080_0010950 3300049742 Bacteria 8299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0439903 Ga0466967_0439903_544_807 79
2 3300025885 Ga0207653_10090751 Ga0207653_100907512 81
3 3300049585 Ga0501069_0015817 Ga0501069_0015817_663_923 81
4 3300049590 Ga0501074_0037822 Ga0501074_0037822_2709_2969 81
5 3300049741 Ga0501079_0333419 Ga0501079_0333419_137_397 81
6 3300049742 Ga0501080_0010950 Ga0501080_0010950_5151_5411 81
7 3300012495 Ga0157323_1040621 Ga0157323_10406211 82
8 3300025932 Ga0207690_10863678 Ga0207690_108636782 82
9 3300025961 Ga0207712_10436196 Ga0207712_104361962 82
10 3300041512 Ga0451853_2559687 Ga0451853_2559687_194_472 82
11 3300048924 Ga0496121_0002122 Ga0496121_0002122_9763_10026 82
12 3300048929 Ga0496126_0679970 Ga0496126_0679970_54_317 82
13 3300028556 Ga0265337_1001587 Ga0265337_10015872 83
14 3300028558 Ga0265326_10035985 Ga0265326_100359852 83
15 3300028563 Ga0265319_1000144 Ga0265319_100014411 83
16 3300028577 Ga0265318_10003597 Ga0265318_100035972 83
17 3300028654 Ga0265322_10003919 Ga0265322_100039193 83
18 3300028666 Ga0265336_10000002 Ga0265336_10000002425 83
19 3300028800 Ga0265338_10000001 Ga0265338_10000001388 83
20 3300029957 Ga0265324_10022189 Ga0265324_100221891 83
21 3300031247 Ga0265340_10000001 Ga0265340_10000001387 83
22 3300031249 Ga0265339_10090903 Ga0265339_100909032 83
23 3300031344 Ga0265316_10052429 Ga0265316_100524292 83
24 3300031712 Ga0265342_10067445 Ga0265342_100674452 83
25 3300031903 Ga0307407_11393896 Ga0307407_113938962 83
26 3300031995 Ga0307409_100586503 Ga0307409_1005865032 83
27 3300032002 Ga0307416_102706192 Ga0307416_1027061921 83
28 3300035170 Ga0373943_0172146 Ga0373943_0172146_855_1160 83
29 3300035171 Ga0373946_0219875 Ga0373946_0219875_548_853 83
30 3300035725 Ga0373947_0107469 Ga0373947_0107469_438_743 83
31 3300037068 Ga0373925_0344503 Ga0373925_0344503_702_1007 83
32 3300045976 Ga0466967_2013297 Ga0466967_2013297_206_472 83
33 3300046473 Ga0495582_0210823 Ga0495582_0210823_264_569 83
34 3300046683 Ga0495658_0567192 Ga0495658_0567192_212_517 83
35 3300046690 Ga0495624_0572368 Ga0495624_0572368_185_490 83
36 3300047321 Ga0495676_0204279 Ga0495676_0204279_524_829 83
37 3300005434 Ga0070709_10733195 Ga0070709_107331951 84
38 3300005445 Ga0070708_101168786 Ga0070708_1011687862 84
39 3300005467 Ga0070706_101399065 Ga0070706_1013990652 84
40 3300005468 Ga0070707_100294603 Ga0070707_1002946032 84
41 3300005983 Ga0081540_1002040 Ga0081540_10020402 84
42 3300005983 Ga0081540_1052469 Ga0081540_10524692 84
43 3300005985 Ga0081539_10003284 Ga0081539_1000328410 84
44 3300006358 Ga0068871_101817018 Ga0068871_1018170182 84
45 3300006847 Ga0075431_100352191 Ga0075431_1003521912 84
46 3300006881 Ga0068865_102160657 Ga0068865_1021606571 84
47 3300009098 Ga0105245_10637208 Ga0105245_106372082 84
48 3300009148 Ga0105243_11091388 Ga0105243_110913881 84
49 3300009553 Ga0105249_10934732 Ga0105249_109347321 84
50 3300010375 Ga0105239_10285047 Ga0105239_102850472 84
51 3300013306 Ga0163162_10882877 Ga0163162_108828772 84
52 3300014497 Ga0182008_10318739 Ga0182008_103187391 84
53 3300025942 Ga0207689_10281344 Ga0207689_102813442 84
54 3300025981 Ga0207640_12101588 Ga0207640_121015882 84
55 3300031852 Ga0307410_10801227 Ga0307410_108012271 84
56 3300031901 Ga0307406_10219285 Ga0307406_102192852 84
57 3300031901 Ga0307406_11358676 Ga0307406_113586761 84
58 3300031903 Ga0307407_10509603 Ga0307407_105096032 84
59 3300031995 Ga0307409_101570186 Ga0307409_1015701861 84
60 3300037466 Ga0395898_0397298 Ga0395898_0397298_733_1002 84
61 3300038443 Ga0395901_0676092 Ga0395901_0676092_224_496 84
62 3300044658 Ga0466972_0179146 Ga0466972_0179146_273_542 84
63 3300044694 Ga0466963_0229193 Ga0466963_0229193_546_815 84
64 3300044694 Ga0466963_0288636 Ga0466963_0288636_569_838 84
65 3300044694 Ga0466963_0730702 Ga0466963_0730702_22_291 84
66 3300044706 Ga0466964_0281286 Ga0466964_0281286_519_788 84
67 3300044706 Ga0466964_0459196 Ga0466964_0459196_152_424 84
68 3300044735 Ga0466968_0697044 Ga0466968_0697044_192_461 84
69 3300044842 Ga0466957_0942693 Ga0466957_0942693_177_446 84
70 3300045836 Ga0466958_1139659 Ga0466958_1139659_88_357 84
71 3300045976 Ga0466967_0006417 Ga0466967_0006417_3393_3662 84
72 3300045976 Ga0466967_0377786 Ga0466967_0377786_359_628 84
73 3300045976 Ga0466967_1279721 Ga0466967_1279721_317_586 84
74 3300048904 Ga0496101_1572294 Ga0496101_1572294_202_471 84
75 3300048905 Ga0496102_0380318 Ga0496102_0380318_947_1216 84
76 3300048917 Ga0496114_0973009 Ga0496114_0973009_53_322 84
77 3300048918 Ga0496115_0000121 Ga0496115_0000121_10604_10873 84
78 3300005338 Ga0068868_100257664 Ga0068868_1002576642 87
79 3300005366 Ga0070659_101022216 Ga0070659_1010222162 87
80 3300005441 Ga0070700_100795690 Ga0070700_1007956902 87
81 3300005547 Ga0070693_100184475 Ga0070693_1001844752 87
82 3300005615 Ga0070702_100123099 Ga0070702_1001230992 87
83 3300005618 Ga0068864_100578896 Ga0068864_1005788962 87
84 3300005834 Ga0068851_10212797 Ga0068851_102127972 87
85 3300009098 Ga0105245_10348213 Ga0105245_103482131 87
86 3300009176 Ga0105242_11839239 Ga0105242_118392392 87
87 3300009553 Ga0105249_11813110 Ga0105249_118131101 87
88 3300013307 Ga0157372_10455512 Ga0157372_104555122 87
89 3300014745 Ga0157377_10061642 Ga0157377_100616422 87
90 3300025321 Ga0207656_10143961 Ga0207656_101439612 87
91 3300025934 Ga0207686_10880259 Ga0207686_108802592 87
92 3300026023 Ga0207677_10495413 Ga0207677_104954132 87
93 3300026075 Ga0207708_10819662 Ga0207708_108196622 87
94 3300026095 Ga0207676_10562932 Ga0207676_105629322 87
95 3300031548 Ga0307408_100056816 Ga0307408_1000568161 87
96 3300031731 Ga0307405_10071113 Ga0307405_100711132 87
97 3300031731 Ga0307405_11262844 Ga0307405_112628441 87
98 3300031824 Ga0307413_10013868 Ga0307413_100138682 87
99 3300031852 Ga0307410_10009712 Ga0307410_100097123 87
100 3300031901 Ga0307406_10200800 Ga0307406_102008002 87
101 3300031903 Ga0307407_10030889 Ga0307407_100308892 87
102 3300031911 Ga0307412_10074026 Ga0307412_100740262 87
103 3300031995 Ga0307409_100545231 Ga0307409_1005452312 87
104 3300032002 Ga0307416_100011415 Ga0307416_1000114155 87
105 3300032004 Ga0307414_10253485 Ga0307414_102534852 87
106 3300032005 Ga0307411_10862871 Ga0307411_108628712 87
107 3300032126 Ga0307415_100238429 Ga0307415_1002384292 87
108 3300048911 Ga0496108_0090095 Ga0496108_0090095_1707_1985 87
109 3300048912 Ga0496109_0307601 Ga0496109_0307601_826_1104 87
110 3300048913 Ga0496110_0335595 Ga0496110_0335595_995_1273 87
111 3300005338 Ga0068868_100651530 Ga0068868_1006515302 88
112 3300005366 Ga0070659_101996149 Ga0070659_1019961492 88
113 3300005614 Ga0068856_100801348 Ga0068856_1008013482 88
114 3300025932 Ga0207690_11166117 Ga0207690_111661171 88
115 3300025945 Ga0207679_10292515 Ga0207679_102925153 88
116 3300025981 Ga0207640_10953691 Ga0207640_109536911 88
117 3300039437 Ga0436365_1160061 Ga0436365_1160061_109_390 88
118 3300044683 Ga0466965_0132148 Ga0466965_0132148_505_831 88
119 3300045976 Ga0466967_1103284 Ga0466967_1103284_433_714 88
120 3300045976 Ga0466967_1961100 Ga0466967_1961100_16_342 88
121 3300048090 Ga0495615_0203689 Ga0495615_0203689_65_349 88
122 3300048909 Ga0496106_0439302 Ga0496106_0439302_744_1028 88
123 3300048913 Ga0496110_0138635 Ga0496110_0138635_1130_1429 88
124 3300049585 Ga0501069_0798997 Ga0501069_0798997_25_306 88
125 3300003373 JGI25407J50210_10083413 JGI25407J50210_100834132 89
126 3300005981 Ga0081538_10000905 Ga0081538_1000090527 89
127 3300006175 Ga0070712_101052953 Ga0070712_1010529532 89
128 3300041443 Ga0451789_0795627 Ga0451789_0795627_71_376 89
129 3300044706 Ga0466964_0201674 Ga0466964_0201674_178_489 89
130 3300044901 Ga0466960_0283069 Ga0466960_0283069_237_563 89
131 3300045976 Ga0466967_0185827 Ga0466967_0185827_1308_1619 89
132 3300045976 Ga0466967_0278168 Ga0466967_0278168_1171_1482 89
133 3300046461 Ga0495641_0047417 Ga0495641_0047417_1116_1421 89
134 3300048903 Ga0496100_1244703 Ga0496100_1244703_34_339 89
135 3300048904 Ga0496101_0368147 Ga0496101_0368147_591_896 89
136 3300048905 Ga0496102_0027563 Ga0496102_0027563_3834_4139 89
137 3300048907 Ga0496104_0003357 Ga0496104_0003357_1882_2187 89
138 3300048908 Ga0496105_0014719 Ga0496105_0014719_2244_2549 89
139 3300048910 Ga0496107_0161409 Ga0496107_0161409_1311_1616 89
140 3300048911 Ga0496108_0004537 Ga0496108_0004537_5782_6087 89
141 3300048912 Ga0496109_0002702 Ga0496109_0002702_8831_9136 89
142 3300048913 Ga0496110_0005789 Ga0496110_0005789_3410_3715 89
143 3300048914 Ga0496111_0004616 Ga0496111_0004616_4615_4920 89
144 3300048915 Ga0496112_0045614 Ga0496112_0045614_3131_3436 89
145 3300048916 Ga0496113_0017764 Ga0496113_0017764_1979_2284 89
146 3300048918 Ga0496115_0277191 Ga0496115_0277191_863_1168 89

Feature Viewer

pLDDT pTM Quality
78.52 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map