F198044

General Info

Members Datasets Scaffolds Average Seq Length
146 108 292 78

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_12185224|Ga0307412_121852242
Length 89
Sequence VNADHADPDLIARLLGPRDPEVSCERCFELLDQYVELELGGKDADARLPGMRAHLEGCPACREDHESLLELVAETSRGSDATNDQGFPR

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
65 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
66 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
67 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
68 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
69 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
70 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
99 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
106 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.96
Rhizosphere 85.62
Stem 0
Stem Tuber 0
Unclassified 13.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_12185224 3300031911 Unclassified 515
2 Ga0070676_10757417 3300005328 Unclassified 713
3 Ga0070683_100188534 3300005329 Bacteria 1958
4 Ga0070671_100088749 3300005355 Bacteria 2588
5 Ga0070714_102316562 3300005435 Bacteria 522
6 Ga0070679_101167448 3300005530 Bacteria 715
7 Ga0070684_100276880 3300005535 Bacteria 1537
8 Ga0070686_101483116 3300005544 Bacteria 571
9 Ga0070696_100383532 3300005546 Bacteria 1096
10 Ga0070693_101314704 3300005547 Bacteria 559
11 Ga0068855_100391200 3300005563 Bacteria 1525
12 Ga0068855_102131396 3300005563 Bacteria 564
13 Ga0068857_102510158 3300005577 Unclassified 506
14 Ga0068854_100860471 3300005578 Bacteria 794
15 Ga0068856_100425638 3300005614 Bacteria 1348
16 Ga0070702_100753348 3300005615 Bacteria 748
17 Ga0068864_100860104 3300005618 Bacteria 894
18 Ga0068861_102206374 3300005719 Unclassified 552
19 Ga0068863_102198821 3300005841 Bacteria 562
20 Ga0081538_10007409 3300005981 Bacteria 9500
21 Ga0081540_1109176 3300005983 Bacteria 1174
22 Ga0081539_10064186 3300005985 Bacteria 2000
23 Ga0075428_101321150 3300006844 Bacteria 758
24 Ga0075431_100691530 3300006847 Unclassified 998
25 Ga0111539_13101128 3300009094 Bacteria 536
26 Ga0105245_10561356 3300009098 Bacteria 1164
27 Ga0114129_10235349 3300009147 Bacteria 2464
28 Ga0105243_11182568 3300009148 Bacteria 777
29 Ga0105248_11038125 3300009177 Bacteria 926
30 Ga0105239_10562991 3300010375 Bacteria 1298
31 Ga0105246_12005769 3300011119 Bacteria 558
32 Ga0157370_11395345 3300013104 Unclassified 630
33 Ga0157369_10010968 3300013105 Bacteria 10315
34 Ga0157369_11175652 3300013105 Unclassified 783
35 Ga0157380_11670773 3300014326 Bacteria 694
36 Ga0182008_10295260 3300014497 Bacteria 847
37 Ga0182008_10570996 3300014497 Bacteria 631
38 Ga0157379_12446110 3300014968 Unclassified 522
39 Ga0163161_10707390 3300017792 Bacteria 839
40 Ga0206353_10037923 3300020082 Bacteria 1356
41 Ga0207693_10225180 3300025915 Bacteria 1473
42 Ga0207687_11221759 3300025927 Bacteria 646
43 Ga0207706_10451693 3300025933 Bacteria 1111
44 Ga0207711_11636745 3300025941 Bacteria 587
45 Ga0207679_11284643 3300025945 Bacteria 672
46 Ga0207668_11687145 3300025972 Bacteria 572
47 Ga0207640_11103856 3300025981 Bacteria 702
48 Ga0207678_10687864 3300026067 Bacteria 900
49 Ga0207702_10668539 3300026078 Bacteria 1022
50 Ga0207676_10752284 3300026095 Bacteria 948
51 Ga0207674_10751150 3300026116 Unclassified 941
52 Ga0207675_101077306 3300026118 Bacteria 823
53 Ga0207683_10383039 3300026121 Bacteria 1293
54 Ga0207428_11291384 3300027907 Unclassified 506
55 Ga0307405_10013047 3300031731 Bacteria 4422
56 Ga0307405_10152197 3300031731 Bacteria 1628
57 Ga0307405_10750823 3300031731 Bacteria 813
58 Ga0307413_10046364 3300031824 Bacteria 2584
59 Ga0307413_12197251 3300031824 Bacteria 500
60 Ga0307410_10039542 3300031852 Bacteria 3097
61 Ga0307410_10880768 3300031852 Bacteria 766
62 Ga0307410_11018375 3300031852 Bacteria 715
63 Ga0307406_10054666 3300031901 Bacteria 2549
64 Ga0307406_10083403 3300031901 Bacteria 2131
65 Ga0307406_10875956 3300031901 Bacteria 763
66 Ga0307407_10033956 3300031903 Bacteria 2788
67 Ga0307407_10067753 3300031903 Bacteria 2111
68 Ga0307412_10293911 3300031911 Bacteria 1281
69 Ga0307409_100000325 3300031995 Bacteria 19628
70 Ga0307409_100130738 3300031995 Bacteria 2145
71 Ga0307409_100167215 3300031995 Bacteria 1931
72 Ga0307409_100440555 3300031995 Bacteria 1255
73 Ga0307409_100501551 3300031995 Unclassified 1182
74 Ga0307416_100005849 3300032002 Bacteria 7626
75 Ga0307416_100747521 3300032002 Bacteria 1070
76 Ga0307416_102171609 3300032002 Bacteria 657
77 Ga0307416_102645851 3300032002 Bacteria 599
78 Ga0307416_103406661 3300032002 Bacteria 532
79 Ga0307414_10027889 3300032004 Bacteria 3655
80 Ga0307414_10213824 3300032004 Bacteria 1578
81 Ga0307414_11399646 3300032004 Unclassified 650
82 Ga0307411_10476066 3300032005 Bacteria 1050
83 Ga0307411_10772406 3300032005 Bacteria 844
84 Ga0307411_11103876 3300032005 Bacteria 715
85 Ga0307415_100005949 3300032126 Bacteria 6537
86 Ga0307415_100042708 3300032126 Bacteria 3019
87 Ga0307415_100085504 3300032126 Bacteria 2266
88 Ga0307415_100400223 3300032126 Bacteria 1172
89 Ga0307415_101282793 3300032126 Bacteria 693
90 Ga0307415_101319832 3300032126 Unclassified 684
91 Ga0395898_1567901 3300037466 Bacteria 583
92 Ga0395901_0206548 3300038443 Bacteria 2057
93 Ga0395901_0863574 3300038443 Bacteria 889
94 Ga0395901_1196284 3300038443 Bacteria 726
95 Ga0242420_108004 3300038996 Unclassified 597
96 Ga0451793_0486454 3300041452 Bacteria 1113
97 Ga0451807_2023859 3300041486 Bacteria 1117
98 Ga0451835_1200314 3300041492 Bacteria 598
99 Ga0451847_0161967 3300041503 Bacteria 503
100 Ga0451843_1668355 3300041509 Bacteria 1197
101 Ga0451855_0507714 3300041511 Bacteria 1131
102 Ga0451853_1583377 3300041512 Bacteria 1578
103 Ga0451577_0990176 3300042876 Bacteria 755
104 Ga0466965_0211033 3300044683 Bacteria 1032
105 Ga0466966_0018000 3300044684 Bacteria 4666
106 Ga0466963_0148116 3300044694 Bacteria 1629
107 Ga0466960_0957278 3300044901 Bacteria 524
108 Ga0466959_0917573 3300045049 Unclassified 584
109 Ga0466958_0115628 3300045836 Bacteria 1676
110 Ga0466967_0792761 3300045976 Bacteria 941
111 Ga0466967_1584208 3300045976 Unclassified 652
112 Ga0495628_0790247 3300046516 Bacteria 665
113 Ga0496101_1071187 3300048904 Unclassified 633
114 Ga0496102_0034991 3300048905 Bacteria 4521
115 Ga0496104_0517563 3300048907 Bacteria 1104
116 Ga0496105_0262986 3300048908 Bacteria 1395
117 Ga0496106_0005239 3300048909 Bacteria 9608
118 Ga0496107_0000545 3300048910 Bacteria 21061
119 Ga0496108_0031949 3300048911 Bacteria 4369
120 Ga0496109_0086356 3300048912 Bacteria 2897
121 Ga0496109_0415738 3300048912 Bacteria 1271
122 Ga0496110_0211410 3300048913 Bacteria 1763
123 Ga0496111_0115940 3300048914 Bacteria 1975
124 Ga0496112_1102539 3300048915 Bacteria 712
125 Ga0496112_1115585 3300048915 Bacteria 707
126 Ga0496113_0296292 3300048916 Unclassified 1295
127 Ga0501031_0466775 3300049568 Bacteria 815
128 Ga0501033_0089245 3300049570 Bacteria 2255
129 Ga0501036_0330289 3300049572 Bacteria 1274
130 Ga0501042_1247901 3300049578 Bacteria 542
131 Ga0501047_0044921 3300049581 Bacteria 4270
132 Ga0501067_0237254 3300049583 Bacteria 1015
133 Ga0501069_1032336 3300049585 Bacteria 503
134 Ga0501070_1395553 3300049586 Bacteria 532
135 Ga0501071_0547450 3300049587 Bacteria 889
136 Ga0501071_1019052 3300049587 Bacteria 639
137 Ga0501073_0693978 3300049589 Bacteria 702
138 Ga0501074_0401793 3300049590 Bacteria 972
139 Ga0501076_0533251 3300049592 Bacteria 968
140 Ga0501076_1482392 3300049592 Bacteria 557
141 Ga0501251_095264 3300049681 Unclassified 539
142 Ga0501271_003171 3300049768 Bacteria 1507
143 nmdc:mga05p37_1085253_c1 3300050507 Bacteria 840
144 nmdc:mga05p37_1784784_c1 3300050507 Bacteria 594
145 nmdc:mga05p37_1896336_c1 3300050507 Bacteria 569
146 nmdc:mga06r32_491170_c1 3300050510 Bacteria 1205
147 Ga0307412_12185224
148 Ga0070676_10757417
149 Ga0070683_100188534
150 Ga0070671_100088749
151 Ga0070714_102316562
152 Ga0070679_101167448
153 Ga0070684_100276880
154 Ga0070686_101483116
155 Ga0070696_100383532
156 Ga0070693_101314704
157 Ga0068855_100391200
158 Ga0068855_102131396
159 Ga0068857_102510158
160 Ga0068854_100860471
161 Ga0068856_100425638
162 Ga0070702_100753348
163 Ga0068864_100860104
164 Ga0068861_102206374
165 Ga0068863_102198821
166 Ga0081538_10007409
167 Ga0081540_1109176
168 Ga0081539_10064186
169 Ga0075428_101321150
170 Ga0075431_100691530
171 Ga0111539_13101128
172 Ga0105245_10561356
173 Ga0114129_10235349
174 Ga0105243_11182568
175 Ga0105248_11038125
176 Ga0105239_10562991
177 Ga0105246_12005769
178 Ga0157370_11395345
179 Ga0157369_10010968
180 Ga0157369_11175652
181 Ga0157380_11670773
182 Ga0182008_10295260
183 Ga0182008_10570996
184 Ga0157379_12446110
185 Ga0163161_10707390
186 Ga0206353_10037923
187 Ga0207693_10225180
188 Ga0207687_11221759
189 Ga0207706_10451693
190 Ga0207711_11636745
191 Ga0207679_11284643
192 Ga0207668_11687145
193 Ga0207640_11103856
194 Ga0207678_10687864
195 Ga0207702_10668539
196 Ga0207676_10752284
197 Ga0207674_10751150
198 Ga0207675_101077306
199 Ga0207683_10383039
200 Ga0207428_11291384
201 Ga0307405_10013047
202 Ga0307405_10152197
203 Ga0307405_10750823
204 Ga0307413_10046364
205 Ga0307413_12197251
206 Ga0307410_10039542
207 Ga0307410_10880768
208 Ga0307410_11018375
209 Ga0307406_10054666
210 Ga0307406_10083403
211 Ga0307406_10875956
212 Ga0307407_10033956
213 Ga0307407_10067753
214 Ga0307412_10293911
215 Ga0307409_100000325
216 Ga0307409_100130738
217 Ga0307409_100167215
218 Ga0307409_100440555
219 Ga0307409_100501551
220 Ga0307416_100005849
221 Ga0307416_100747521
222 Ga0307416_102171609
223 Ga0307416_102645851
224 Ga0307416_103406661
225 Ga0307414_10027889
226 Ga0307414_10213824
227 Ga0307414_11399646
228 Ga0307411_10476066
229 Ga0307411_10772406
230 Ga0307411_11103876
231 Ga0307415_100005949
232 Ga0307415_100042708
233 Ga0307415_100085504
234 Ga0307415_100400223
235 Ga0307415_101282793
236 Ga0307415_101319832
237 Ga0395898_1567901
238 Ga0395901_0206548
239 Ga0395901_0863574
240 Ga0395901_1196284
241 Ga0242420_108004
242 Ga0451793_0486454
243 Ga0451807_2023859
244 Ga0451835_1200314
245 Ga0451847_0161967
246 Ga0451843_1668355
247 Ga0451855_0507714
248 Ga0451853_1583377
249 Ga0451577_0990176
250 Ga0466965_0211033
251 Ga0466966_0018000
252 Ga0466963_0148116
253 Ga0466960_0957278
254 Ga0466959_0917573
255 Ga0466958_0115628
256 Ga0466967_0792761
257 Ga0466967_1584208
258 Ga0495628_0790247
259 Ga0496101_1071187
260 Ga0496102_0034991
261 Ga0496104_0517563
262 Ga0496105_0262986
263 Ga0496106_0005239
264 Ga0496107_0000545
265 Ga0496108_0031949
266 Ga0496109_0086356
267 Ga0496109_0415738
268 Ga0496110_0211410
269 Ga0496111_0115940
270 Ga0496112_1102539
271 Ga0496112_1115585
272 Ga0496113_0296292
273 Ga0501031_0466775
274 Ga0501033_0089245
275 Ga0501036_0330289
276 Ga0501042_1247901
277 Ga0501047_0044921
278 Ga0501067_0237254
279 Ga0501069_1032336
280 Ga0501070_1395553
281 Ga0501071_0547450
282 Ga0501071_1019052
283 Ga0501073_0693978
284 Ga0501074_0401793
285 Ga0501076_0533251
286 Ga0501076_1482392
287 Ga0501251_095264
288 Ga0501271_003171
289 nmdc:mga05p37_1085253_c1
290 nmdc:mga05p37_1784784_c1
291 nmdc:mga05p37_1896336_c1
292 nmdc:mga06r32_491170_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map