F197942

General Info

Members Datasets Scaffolds Average Seq Length
146 106 108 95

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10019758|Ga0265324_100197583
Length 110
Sequence MSGDAGPGVGATFSVTLPSGATWTPTFVQSIDEAKCIGCGRCFRVCPRGVLELVGLDDEGERIALDPDGDEEEEYEKKVMTIAHRELCIGCTACSKICPKKCYTHAAASA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
9 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
10 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
11 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
12 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
13 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
14 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
15 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
16 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
17 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
18 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
19 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
20 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
21 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
22 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
23 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
24 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
25 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
26 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
27 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
28 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
29 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
30 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
31 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
53 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
58 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
63 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
64 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
75 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
76 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
77 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
80 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
81 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
82 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
83 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
84 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
85 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
86 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
87 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
88 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
89 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
92 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
93 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
94 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
95 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
96 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
100 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
101 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
102 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
103 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
104 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
105 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
106 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.97
Metatranscriptomes 0
Isolates 26.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 8.22
Rhizoplane 1.37
Rhizosphere 67.81
Stem 0
Stem Tuber 0
Unclassified 19.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1019042 3300002741 Bacteria 825
2 rootH1_10003087 3300003316 Bacteria 52943
3 rootL2_10006881 3300003322 Bacteria 64959
4 rootL2_10021865 3300003322 Bacteria 3099
5 Ga0065704_10533116 3300005289 Bacteria 646
6 Ga0070667_100694648 3300005367 Bacteria 941
7 Ga0068867_100000066 3300005459 Bacteria 63559
8 Ga0070699_101321498 3300005518 Bacteria 661
9 Ga0068860_100107419 3300005843 Bacteria 2667
10 Ga0075367_10260360 3300006178 Bacteria 1089
11 Ga0075369_10337374 3300006186 Bacteria 706
12 Ga0075366_10076468 3300006195 Bacteria 1998
13 Ga0075430_100046873 3300006846 Bacteria 3650
14 Ga0075430_100445583 3300006846 Bacteria 1069
15 Ga0075429_100000138 3300006880 Bacteria 43993
16 Ga0075429_100690541 3300006880 Bacteria 894
17 Ga0105243_10003572 3300009148 Bacteria 12555
18 Ga0157377_10000035 3300014745 Bacteria 116860
19 Ga0209026_1001119 3300025250 Bacteria 12693
20 Ga0207709_10000858 3300025935 Bacteria 23259
21 Ga0207648_10000040 3300026089 Bacteria 116539
22 Ga0268264_10057976 3300028381 Bacteria 3241
23 Ga0265336_10000013 3300028666 Bacteria 252156
24 Ga0307515_10369804 3300028794 Bacteria 1071
25 Ga0265324_10006254 3300029957 Bacteria 5000
26 Ga0265324_10019758 3300029957 Bacteria 2425
27 Ga0265324_10216075 3300029957 Bacteria 651
28 Ga0265328_10000001 3300031239 Bacteria 371500
29 Ga0265328_10003243 3300031239 Bacteria 7212
30 Ga0265328_10055022 3300031239 Bacteria 1460
31 Ga0265331_10000050 3300031250 Bacteria 181286
32 Ga0265331_10030370 3300031250 Bacteria 2690
33 Ga0265331_10081321 3300031250 Unclassified 1504
34 Ga0265331_10108074 3300031250 Bacteria 1277
35 Ga0265327_10000109 3300031251 Bacteria 181275
36 Ga0265327_10000283 3300031251 Bacteria 100296
37 Ga0265327_10000681 3300031251 Bacteria 54587
38 Ga0265327_10001132 3300031251 Bacteria 36609
39 Ga0265327_10005810 3300031251 Bacteria 10135
40 Ga0265327_10025567 3300031251 Bacteria 3439
41 Ga0265327_10030331 3300031251 Bacteria 3059
42 Ga0265327_10215030 3300031251 Bacteria 866
43 Ga0265316_10281568 3300031344 Bacteria 1215
44 Ga0265316_10458148 3300031344 Bacteria 914
45 Ga0265316_10919372 3300031344 Bacteria 611
46 Ga0307514_10002630 3300031649 Bacteria 18347
47 Ga0307516_10176458 3300031730 Bacteria 1873
48 Ga0307406_11107298 3300031901 Bacteria 684
49 Ga0307412_10035528 3300031911 Bacteria 3185
50 Ga0307416_100147453 3300032002 Bacteria 2151
51 Ga0316583_10057038 3300032133 Bacteria 1372
52 Ga0373952_0142943 3300035092 Bacteria 666
53 Ga0373955_0555154 3300035172 Bacteria 703
54 Ga0373931_0228198 3300035691 Bacteria 1124
55 Ga0395898_0438750 3300037466 Bacteria 1244
56 Ga0395905_0001078 3300037471 Bacteria 34323
57 Ga0395905_0004033 3300037471 Bacteria 15413
58 Ga0395905_0099813 3300037471 Bacteria 2726
59 Ga0395905_0815271 3300037471 Bacteria 836
60 Ga0395901_0235064 3300038443 Bacteria 1913
61 Ga0439459_0091413 3300042438 Bacteria 732
62 Ga0451577_0000166 3300042876 Bacteria 145166
63 Ga0451577_0009283 3300042876 Bacteria 9480
64 Ga0451577_0009504 3300042876 Bacteria 9357
65 Ga0451577_1998277 3300042876 Bacteria 507
66 Ga0453683_0009961 3300044673 Bacteria 6322
67 Ga0453684_0000187 3300044712 Bacteria 272378
68 Ga0453684_0010999 3300044712 Bacteria 15294
69 Ga0453684_0036105 3300044712 Bacteria 6817
70 Ga0453684_0103701 3300044712 Bacteria 3474
71 Ga0453684_0144631 3300044712 Bacteria 2834
72 Ga0453684_0155132 3300044712 Bacteria 2716
73 Ga0453684_0223552 3300044712 Bacteria 2179
74 Ga0453684_0425584 3300044712 Bacteria 1482
75 Ga0453684_0431681 3300044712 Bacteria 1470
76 Ga0451576_0001582 3300045051 Bacteria 38269
77 Ga0451576_0027118 3300045051 Bacteria 6156
78 Ga0451576_0042005 3300045051 Bacteria 4828
79 Ga0451576_0168723 3300045051 Bacteria 2284
80 Ga0495590_0011237 3300046457 Bacteria 3352
81 Ga0495616_0308613 3300046513 Bacteria 667
82 Ga0495654_0211691 3300046530 Bacteria 824
83 Ga0495660_0026487 3300046810 Bacteria 3287
84 Ga0496112_1457174 3300048915 Bacteria 599
85 Ga0496113_0274436 3300048916 Bacteria 1348
86 Ga0496121_0024854 3300048924 Bacteria 5712
87 Ga0496122_0000531 3300048925 Bacteria 79144
88 Ga0496123_0000581 3300048926 Bacteria 62266
89 Ga0496124_0005099 3300048927 Bacteria 14957
90 Ga0501290_052497 3300049513 Bacteria 638
91 Ga0501295_203266 3300049518 Bacteria 500
92 Ga0501298_023436 3300049521 Bacteria 1170
93 Ga0501300_006287 3300049523 Bacteria 1750
94 Ga0501301_001692 3300049524 Bacteria 1415
95 Ga0501303_002524 3300049526 Bacteria 1418
96 Ga0501047_0127947 3300049581 Bacteria 2420
97 Ga0501206_003850 3300049653 Bacteria 1905
98 Ga0501262_012465 3300049759 Bacteria 1087
99 Ga0501265_004825 3300049762 Bacteria 1546
100 Ga0501280_000471 3300049776 Bacteria 9578
101 Ga0501282_001238 3300049778 Bacteria 2868
102 nmdc:mga0k408_71513_c1 3300050493 Bacteria 2025
103 nmdc:mga09592_192441_c1 3300050508 Bacteria 1765
104 nmdc:mga09592_4527_c1 3300050508 Bacteria 11245
105 nmdc:mga0qj67_155016_c1 3300050509 Bacteria 1859
106 nmdc:mga0qj67_254758_c1 3300050509 Bacteria 1424
107 nmdc:mga0qj67_826691_c1 3300050509 Bacteria 732
108 Ga0500618_000884 3300053125 Bacteria 15896

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006186 Ga0075369_10337374 Ga0075369_103373742 74
2 iso_pu_bacteria 644736347 644749835 83
3 iso_pu_bacteria 2551306416 2553007359 84
4 iso_pu_bacteria 2818991449 2819613992 84
5 iso_pu_bacteria 2923510766 2923511719 84
6 iso_pu_bacteria 2928115317 2928117748 84
7 3300031239 Ga0265328_10000001 Ga0265328_1000000150 85
8 3300031250 Ga0265331_10108074 Ga0265331_101080742 85
9 iso_pu_bacteria 2501025501 2501071294 85
10 iso_pu_bacteria 2501025502 2501079515 85
11 iso_pu_bacteria 2501025504 2501414179 85
12 iso_pu_bacteria 2510065045 2510246321 85
13 iso_pu_bacteria 2510065045 2510249613 85
14 iso_pu_bacteria 2510917013 2511093870 85
15 iso_pu_bacteria 2510917014 2511094568 85
16 iso_pu_bacteria 2510917015 2511104272 85
17 iso_pu_bacteria 2512047030 2512348696 85
18 iso_pu_bacteria 2513237166 2514055858 85
19 iso_pu_bacteria 2515154122 2515685639 85
20 iso_pu_bacteria 2526164713 2527080456 85
21 iso_pu_bacteria 2582581311 2585291708 85
22 iso_pu_bacteria 2600255067 2600813536 85
23 iso_pu_bacteria 2718217991 2719641986 85
24 iso_pu_bacteria 2751185846 2753569228 85
25 iso_pu_bacteria 2791355137 2792841354 85
26 iso_pu_bacteria 2816332253 2817262693 85
27 iso_pu_bacteria 2816332256 2817276235 85
28 iso_pu_bacteria 2816332286 2817453678 85
29 iso_pu_bacteria 2856287931 2856291669 85
30 iso_pu_bacteria 2857357740 2857361610 85
31 iso_pu_bacteria 2885270888 2885272277 85
32 iso_pu_bacteria 2900634093 2900643140 85
33 iso_pu_bacteria 2902682994 2902687556 85
34 iso_pu_bacteria 2904615490 2904617802 85
35 iso_pu_bacteria 2921643360 2921647999 85
36 iso_pu_bacteria 642555112 642599263 85
37 iso_pu_bacteria 8020807995 8020809666 85
38 iso_pu_bacteria 8040167225 8040168552 85
39 iso_pu_bacteria 8040173305 8040178343 85
40 iso_pu_bacteria 8055266321 8055268501 85
41 iso_pu_bacteria 8055301274 8055308764 85
42 3300031250 Ga0265331_10030370 Ga0265331_100303704 86
43 3300031251 Ga0265327_10000283 Ga0265327_1000028391 86
44 3300031251 Ga0265327_10030331 Ga0265327_100303313 86
45 3300048924 Ga0496121_0024854 Ga0496121_0024854_2384_2701 86
46 3300031239 Ga0265328_10003243 Ga0265328_100032433 87
47 3300031239 Ga0265328_10055022 Ga0265328_100550223 87
48 3300031250 Ga0265331_10000050 Ga0265331_1000005042 87
49 3300031251 Ga0265327_10000109 Ga0265327_10000109183 87
50 3300031251 Ga0265327_10000681 Ga0265327_1000068128 87
51 3300031251 Ga0265327_10005810 Ga0265327_100058108 87
52 3300031344 Ga0265316_10281568 Ga0265316_102815684 87
53 3300031344 Ga0265316_10919372 Ga0265316_109193722 87
54 3300031730 Ga0307516_10176458 Ga0307516_101764583 87
55 3300044712 Ga0453684_0431681 Ga0453684_0431681_407_709 87
56 3300049523 Ga0501300_006287 Ga0501300_006287_953_1261 87
57 3300049776 Ga0501280_000471 Ga0501280_000471_7745_8053 87
58 3300049778 Ga0501282_001238 Ga0501282_001238_708_1016 87
59 3300002741 JGI25157J39369_1019042 JGI25157J39369_10190421 88
60 3300003316 rootH1_10003087 rootH1_1000308719 88
61 3300003322 rootL2_10006881 rootL2_1000688152 88
62 3300003322 rootL2_10021865 rootL2_100218655 88
63 3300005289 Ga0065704_10533116 Ga0065704_105331161 88
64 3300005367 Ga0070667_100694648 Ga0070667_1006946481 88
65 3300005459 Ga0068867_100000066 Ga0068867_10000006642 88
66 3300005518 Ga0070699_101321498 Ga0070699_1013214981 88
67 3300005843 Ga0068860_100107419 Ga0068860_1001074195 88
68 3300006178 Ga0075367_10260360 Ga0075367_102603602 88
69 3300006195 Ga0075366_10076468 Ga0075366_100764684 88
70 3300006846 Ga0075430_100046873 Ga0075430_1000468736 88
71 3300006846 Ga0075430_100445583 Ga0075430_1004455833 88
72 3300006880 Ga0075429_100000138 Ga0075429_10000013811 88
73 3300006880 Ga0075429_100690541 Ga0075429_1006905412 88
74 3300009148 Ga0105243_10003572 Ga0105243_100035727 88
75 3300014745 Ga0157377_10000035 Ga0157377_1000003542 88
76 3300025250 Ga0209026_1001119 Ga0209026_10011193 88
77 3300025935 Ga0207709_10000858 Ga0207709_1000085815 88
78 3300026089 Ga0207648_10000040 Ga0207648_1000004041 88
79 3300028381 Ga0268264_10057976 Ga0268264_100579765 88
80 3300028666 Ga0265336_10000013 Ga0265336_1000001398 88
81 3300028794 Ga0307515_10369804 Ga0307515_103698043 88
82 3300029957 Ga0265324_10006254 Ga0265324_100062547 88
83 3300029957 Ga0265324_10019758 Ga0265324_100197583 88
84 3300029957 Ga0265324_10216075 Ga0265324_102160753 88
85 3300031250 Ga0265331_10081321 Ga0265331_100813213 88
86 3300031251 Ga0265327_10001132 Ga0265327_1000113211 88
87 3300031251 Ga0265327_10025567 Ga0265327_100255673 88
88 3300031251 Ga0265327_10215030 Ga0265327_102150301 88
89 3300031344 Ga0265316_10458148 Ga0265316_104581482 88
90 3300031649 Ga0307514_10002630 Ga0307514_1000263018 88
91 3300031901 Ga0307406_11107298 Ga0307406_111072981 88
92 3300031911 Ga0307412_10035528 Ga0307412_100355283 88
93 3300032002 Ga0307416_100147453 Ga0307416_1001474533 88
94 3300032133 Ga0316583_10057038 Ga0316583_100570383 88
95 3300035092 Ga0373952_0142943 Ga0373952_0142943_96_404 88
96 3300035172 Ga0373955_0555154 Ga0373955_0555154_80_388 88
97 3300035691 Ga0373931_0228198 Ga0373931_0228198_332_640 88
98 3300037466 Ga0395898_0438750 Ga0395898_0438750_285_590 88
99 3300037471 Ga0395905_0001078 Ga0395905_0001078_2173_2481 88
100 3300037471 Ga0395905_0004033 Ga0395905_0004033_5930_6235 88
101 3300037471 Ga0395905_0099813 Ga0395905_0099813_581_886 88
102 3300037471 Ga0395905_0815271 Ga0395905_0815271_199_504 88
103 3300038443 Ga0395901_0235064 Ga0395901_0235064_61_366 88
104 3300042438 Ga0439459_0091413 Ga0439459_0091413_121_432 88
105 3300042876 Ga0451577_0000166 Ga0451577_0000166_3319_3627 88
106 3300042876 Ga0451577_0009283 Ga0451577_0009283_2849_3160 88
107 3300042876 Ga0451577_0009504 Ga0451577_0009504_7055_7360 88
108 3300042876 Ga0451577_1998277 Ga0451577_1998277_142_456 88
109 3300044673 Ga0453683_0009961 Ga0453683_0009961_5894_6199 88
110 3300044712 Ga0453684_0000187 Ga0453684_0000187_265242_265550 88
111 3300044712 Ga0453684_0010999 Ga0453684_0010999_6580_6885 88
112 3300044712 Ga0453684_0036105 Ga0453684_0036105_167_478 88
113 3300044712 Ga0453684_0103701 Ga0453684_0103701_2997_3308 88
114 3300044712 Ga0453684_0144631 Ga0453684_0144631_2230_2535 88
115 3300044712 Ga0453684_0155132 Ga0453684_0155132_1296_1610 88
116 3300044712 Ga0453684_0223552 Ga0453684_0223552_1792_2097 88
117 3300044712 Ga0453684_0425584 Ga0453684_0425584_549_857 88
118 3300045051 Ga0451576_0001582 Ga0451576_0001582_34827_35135 88
119 3300045051 Ga0451576_0027118 Ga0451576_0027118_3810_4115 88
120 3300045051 Ga0451576_0042005 Ga0451576_0042005_2984_3295 88
121 3300045051 Ga0451576_0168723 Ga0451576_0168723_90_395 88
122 3300046457 Ga0495590_0011237 Ga0495590_0011237_1021_1326 88
123 3300046513 Ga0495616_0308613 Ga0495616_0308613_254_559 88
124 3300046530 Ga0495654_0211691 Ga0495654_0211691_258_563 88
125 3300046810 Ga0495660_0026487 Ga0495660_0026487_336_641 88
126 3300048915 Ga0496112_1457174 Ga0496112_1457174_173_481 88
127 3300048916 Ga0496113_0274436 Ga0496113_0274436_193_504 88
128 3300048925 Ga0496122_0000531 Ga0496122_0000531_27543_27848 88
129 3300048926 Ga0496123_0000581 Ga0496123_0000581_21648_21953 88
130 3300048927 Ga0496124_0005099 Ga0496124_0005099_8250_8555 88
131 3300049513 Ga0501290_052497 Ga0501290_052497_14_319 88
132 3300049518 Ga0501295_203266 Ga0501295_203266_131_436 88
133 3300049521 Ga0501298_023436 Ga0501298_023436_641_946 88
134 3300049524 Ga0501301_001692 Ga0501301_001692_668_973 88
135 3300049526 Ga0501303_002524 Ga0501303_002524_253_558 88
136 3300049581 Ga0501047_0127947 Ga0501047_0127947_1848_2153 88
137 3300049653 Ga0501206_003850 Ga0501206_003850_1397_1702 88
138 3300049759 Ga0501262_012465 Ga0501262_012465_32_337 88
139 3300049762 Ga0501265_004825 Ga0501265_004825_580_885 88
140 3300050493 nmdc:mga0k408_71513_c1 nmdc:mga0k408_71513_c1_849_1157 88
141 3300050508 nmdc:mga09592_192441_c1 nmdc:mga09592_192441_c1_738_1043 88
142 3300050508 nmdc:mga09592_4527_c1 nmdc:mga09592_4527_c1_5530_5835 88
143 3300050509 nmdc:mga0qj67_155016_c1 nmdc:mga0qj67_155016_c1_1280_1585 88
144 3300050509 nmdc:mga0qj67_254758_c1 nmdc:mga0qj67_254758_c1_271_576 88
145 3300050509 nmdc:mga0qj67_826691_c1 nmdc:mga0qj67_826691_c1_401_706 88
146 3300053125 Ga0500618_000884 Ga0500618_000884_9493_9798 88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12837

Fer4_6

4Fe-4S binding domain

30

51

0.94

PF00037

Fer4

4Fe-4S binding domain

30

52

0.93

PF12797

Fer4_2

4Fe-4S binding domain

27

48

0.92

PF12800

Fer4_4

4Fe-4S binding domain

85

103

0.92

PF12800

Fer4_4

4Fe-4S binding domain

33

49

0.91

PF13237

Fer4_10

4Fe-4S dicluster domain

29

99

0.9

PF13484

Fer4_16

4Fe-4S double cluster binding domain

35

101

0.83

PF14697

Fer4_21

4Fe-4S dicluster domain

29

105

0.82

PF12838

Fer4_7

4Fe-4S dicluster domain

35

102

0.74

PF13534

Fer4_17

4Fe-4S dicluster domain

35

102

0.68

PF13183

Fer4_8

4Fe-4S dicluster domain

32

102

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odi-assembly1.cif.gz_A heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus cocrystallized with com-sh 0.8295 18 83
7npa-assembly4.cif.gz_M crystal structure of the coenzyme f420-dependent sulfite reductase from methanothermococcus thermolithotrophicus at 1.55-a resolution 0.821 16 83
7npa-assembly4.cif.gz_N crystal structure of the coenzyme f420-dependent sulfite reductase from methanothermococcus thermolithotrophicus at 1.55-a resolution 0.8191 16 83
7np8-assembly1.cif.gz_B crystal structure of the coenzyme f420-dependent sulfite reductase from methanocaldococcus jannaschii at 2.3-a resolution 0.8182 15 83
8oh5-assembly1.cif.gz_B cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) 0.8158 21 83
ID Description Score Start End Superfamily
4omfG02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8336 27 79 3.30.70.20
af_Q58565_66_146_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8302 21 87 3.30.70.20
1hfeM02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7898 22 80 3.30.70.20
af_Q55EL3_285_498_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7887 2 14 3.40.50.2020
af_O50433_2_106_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.787 21 82 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A1S9CQM7-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9367 18 87 GO:0046872
GO:0051539
AF-A0A354GSL7-F1-model_v4 Ferredoxin 0.9243 21 83 GO:0046872
GO:0051539
AF-A0A6B9TGX2-F1-model_v4 4Fe-4S dicluster domain-containing protein 0.9187 21 86 GO:0016491
GO:0051539
AF-A0A497IVJ4-F1-model_v4 deleted 0.9138 17 88
AF-R9SM07-F1-model_v4 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein 0.9007 21 87 GO:0016491
GO:0051539

Feature Viewer

pLDDT pTM Quality
85.29 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map