F197671

General Info

Members Datasets Scaffolds Average Seq Length
146 112 292 137

Family's Representative Sequence

Representative Sequence 3300025229|Ga0209147_107762|Ga0209147_1077621
Length 149
Sequence MQMQGAQTFRGIATISFWADDLDKAKAWYTELLGIEPYFERPGYAEFRLGDYQQELGLIDRRYAPAGLAKGPGGATLYWHVDDISAVLDKLLSMGVEELEAMKERGGGFITASVVDPFGNIIGIMNNPHYVKVRDSIRGEWFAGGHVCL

Samples

Sample ID Description Type Environment
1 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
52 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
70 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
71 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
72 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
73 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
74 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
75 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
87 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
88 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
89 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
90 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
95 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
96 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
97 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
98 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
99 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
100 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
101 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
102 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
103 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
104 2808606372 Agromyces sp. 23-23 Isolate Unclassified
105 2808606394 Promicromonospora sp. C35 Isolate Unclassified
106 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
107 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
108 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
109 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
110 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
111 8022792930 Bacillus sp. Xin Isolate Rhizosphere
112 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.1
Metatranscriptomes 0
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.59
Nodule 0
Rhizoplane 2.74
Rhizosphere 71.92
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209147_107762 3300025229 Bacteria 1375
2 rootL2_10313515 3300003322 Bacteria 1047
3 JGI25407J50210_10006475 3300003373 Bacteria 2917
4 Ga0055532_1000490 3300003758 Bacteria 17635
5 Ga0070669_100298916 3300005353 Bacteria 1294
6 Ga0070675_100441129 3300005354 Bacteria 1166
7 Ga0070671_100322504 3300005355 Bacteria 1316
8 Ga0070714_100361133 3300005435 Bacteria 1365
9 Ga0070713_100048916 3300005436 Bacteria 3485
10 Ga0070713_100860246 3300005436 Bacteria 871
11 Ga0070713_101053618 3300005436 Bacteria 785
12 Ga0070708_100541035 3300005445 Bacteria 1099
13 Ga0068857_100027264 3300005577 Bacteria 5038
14 Ga0068864_100544239 3300005618 Bacteria 1121
15 Ga0068851_10082045 3300005834 Bacteria 1685
16 Ga0081455_10033142 3300005937 Bacteria 4645
17 Ga0081455_10830761 3300005937 Bacteria 578
18 Ga0081538_10000734 3300005981 Bacteria 35846
19 Ga0081538_10001090 3300005981 Bacteria 28742
20 Ga0081538_10005516 3300005981 Bacteria 11364
21 Ga0081538_10011452 3300005981 Bacteria 7183
22 Ga0081538_10013989 3300005981 Bacteria 6316
23 Ga0081538_10060701 3300005981 Bacteria 2172
24 Ga0070717_10001051 3300006028 Bacteria 18527
25 Ga0075363_100013839 3300006048 Bacteria 3927
26 Ga0070712_100750350 3300006175 Bacteria 835
27 Ga0075428_100080156 3300006844 Bacteria 3563
28 Ga0075430_100006072 3300006846 Bacteria 10184
29 Ga0075430_100165882 3300006846 Bacteria 1838
30 Ga0075431_100090812 3300006847 Bacteria 3153
31 Ga0075431_100619298 3300006847 Bacteria 1065
32 Ga0068865_101548845 3300006881 Bacteria 595
33 Ga0105250_10011093 3300009092 Bacteria 3744
34 Ga0105240_10184475 3300009093 Bacteria 2459
35 Ga0105245_10768144 3300009098 Bacteria 1000
36 Ga0114129_10098784 3300009147 Bacteria 4041
37 Ga0114129_11712658 3300009147 Bacteria 767
38 Ga0105243_10635022 3300009148 Bacteria 1033
39 Ga0105241_10167945 3300009174 Bacteria 1810
40 Ga0105249_10125151 3300009553 Bacteria 2447
41 Ga0105239_11994553 3300010375 Bacteria 674
42 Ga0105246_11091546 3300011119 Bacteria 728
43 Ga0157369_12293040 3300013105 Bacteria 547
44 Ga0163162_10275096 3300013306 Bacteria 1816
45 Ga0157375_12097466 3300013308 Bacteria 673
46 Ga0209147_100057 3300025229 Bacteria 253870
47 Ga0209025_1001084 3300025294 Bacteria 39385
48 Ga0207655_1005090 3300025728 Bacteria 9086
49 Ga0207699_10632923 3300025906 Bacteria 780
50 Ga0207654_10937518 3300025911 Bacteria 628
51 Ga0207664_11211568 3300025929 Bacteria 673
52 Ga0207704_10316922 3300025938 Bacteria 1201
53 Ga0207679_10836288 3300025945 Bacteria 840
54 Ga0207712_10905337 3300025961 Bacteria 780
55 Ga0207668_10014649 3300025972 Bacteria 4855
56 Ga0207708_10346982 3300026075 Bacteria 1217
57 Ga0207674_10195105 3300026116 Bacteria 1975
58 Ga0268265_11454813 3300028380 Bacteria 688
59 Ga0307517_10298216 3300028786 Bacteria 906
60 Ga0307515_10000024 3300028794 Bacteria 393119
61 Ga0307515_10125561 3300028794 Bacteria 2870
62 Ga0307512_10157962 3300030522 Bacteria 1337
63 Ga0307513_10251269 3300031456 Bacteria 1565
64 Ga0307509_10231294 3300031507 Unclassified 1651
65 Ga0307516_10010944 3300031730 Bacteria 9919
66 Ga0307405_10035397 3300031731 Bacteria 2981
67 Ga0307413_10057612 3300031824 Bacteria 2377
68 Ga0307413_10074671 3300031824 Bacteria 2148
69 Ga0307410_10187495 3300031852 Bacteria 1571
70 Ga0307410_11393490 3300031852 Bacteria 615
71 Ga0307406_10039378 3300031901 Bacteria 2932
72 Ga0307407_10082720 3300031903 Bacteria 1946
73 Ga0307407_10171785 3300031903 Bacteria 1428
74 Ga0307407_10944964 3300031903 Bacteria 664
75 Ga0307412_10094308 3300031911 Bacteria 2101
76 Ga0307409_100023455 3300031995 Bacteria 4277
77 Ga0307416_100191932 3300032002 Bacteria 1927
78 Ga0307416_101552477 3300032002 Bacteria 768
79 Ga0307416_102768205 3300032002 Bacteria 586
80 Ga0307414_10197471 3300032004 Bacteria 1633
81 Ga0307411_10073914 3300032005 Bacteria 2321
82 Ga0307411_10182205 3300032005 Bacteria 1595
83 Ga0307415_100173249 3300032126 Bacteria 1685
84 Ga0307415_100346646 3300032126 Bacteria 1248
85 Ga0307415_100549454 3300032126 Bacteria 1019
86 Ga0307507_10178935 3300033179 Bacteria 1521
87 Ga0395900_0020882 3300037418 Bacteria 6691
88 Ga0395900_0580287 3300037418 Bacteria 1063
89 Ga0395898_0037248 3300037466 Bacteria 4826
90 Ga0395898_0999707 3300037466 Bacteria 772
91 Ga0395905_0020331 3300037471 Bacteria 6289
92 Ga0395905_1686095 3300037471 Bacteria 539
93 Ga0395901_0013334 3300038443 Bacteria 8349
94 Ga0395901_0182493 3300038443 Bacteria 2201
95 Ga0395901_1427016 3300038443 Bacteria 650
96 Ga0451787_466336 3300041441 Bacteria 597
97 Ga0451807_0523929 3300041486 Bacteria 1282
98 Ga0451807_1247116 3300041486 Bacteria 575
99 Ga0451833_1046462 3300041491 Bacteria 1141
100 Ga0451839_0695134 3300041496 Bacteria 1587
101 Ga0451841_0217039 3300041498 Bacteria 3291
102 Ga0451843_0506271 3300041509 Bacteria 990
103 Ga0451855_0194006 3300041511 Bacteria 1092
104 Ga0451853_2518171 3300041512 Bacteria 1065
105 Ga0439448_0157583 3300042005 Bacteria 789
106 Ga0466972_0048199 3300044658 Bacteria 2058
107 Ga0466972_0075857 3300044658 Bacteria 1602
108 Ga0466970_0265523 3300044765 Bacteria 963
109 Ga0495641_0115967 3300046461 Bacteria 1195
110 Ga0495650_0006539 3300046471 Bacteria 7243
111 Ga0495596_0289639 3300046500 Unclassified 636
112 Ga0495668_0000624 3300046616 Bacteria 42812
113 Ga0495625_0278908 3300046660 Unclassified 1076
114 Ga0496114_0170150 3300048917 Bacteria 1898
115 Ga0501269_000498 3300049766 Bacteria 8117
116 nmdc:mga03n38_142950_c1 3300050490 Bacteria 1197
117 nmdc:mga06z11_452175_c1 3300050494 Bacteria 776
118 nmdc:mga09592_1400721_c1 3300050508 Bacteria 572
119 nmdc:mga09592_548975_c1 3300050508 Bacteria 992
120 nmdc:mga0qj67_4486_c1 3300050509 Bacteria 10111
121 nmdc:mga0qj67_559510_c1 3300050509 Bacteria 917
122 nmdc:mga06r32_100738_c1 3300050510 Bacteria 2834
123 nmdc:mga06r32_27456_c1 3300050510 Bacteria 5317
124 nmdc:mga0n895_1907928_c1 3300050512 Bacteria 553
125 nmdc:mga0n895_28928_c1 3300050512 Bacteria 5278
126 nmdc:mga0a205_979551_c1 3300050515 Bacteria 692
127 Ga0500642_0040544 3300053130 Bacteria 2008
128 Ga0500655_076698 3300053133 Bacteria 685
129 Ga0500568_0102457 3300053139 Bacteria 1073
130 Ga0500616_0000012 3300053153 Bacteria 681798
131 Ga0500616_0001380 3300053153 Bacteria 23509
132 Ga0500570_051614 3300053724 Bacteria 2064
133 Ga0500645_096618 3300053730 Unclassified 835
134 2738695787 2738541272 Bacteria 6848551
135 2739326069 2738543027 Bacteria 6409078
136 2739605090 2739367654 Bacteria 6049412
137 2760623408 2758568621 Bacteria 5967089
138 2808902201 2808606372 Bacteria 4649509
139 2809028296 2808606394 Bacteria 6248540
140 2857466376 2857465823 Bacteria 6772595
141 2956902163 2956897341 Bacteria 5447711
142 2966603467 2966598605 Bacteria 7676064
143 2979089336 2979083700 Bacteria 5894929
144 2997452218 2997451912 Bacteria 8492419
145 8022795675 8022792930 Bacteria 5693794
146 8057583951 8057582654 Bacteria 5218944
147 Ga0209147_107762
148 rootL2_10313515
149 JGI25407J50210_10006475
150 Ga0055532_1000490
151 Ga0070669_100298916
152 Ga0070675_100441129
153 Ga0070671_100322504
154 Ga0070714_100361133
155 Ga0070713_100048916
156 Ga0070713_100860246
157 Ga0070713_101053618
158 Ga0070708_100541035
159 Ga0068857_100027264
160 Ga0068864_100544239
161 Ga0068851_10082045
162 Ga0081455_10033142
163 Ga0081455_10830761
164 Ga0081538_10000734
165 Ga0081538_10001090
166 Ga0081538_10005516
167 Ga0081538_10011452
168 Ga0081538_10013989
169 Ga0081538_10060701
170 Ga0070717_10001051
171 Ga0075363_100013839
172 Ga0070712_100750350
173 Ga0075428_100080156
174 Ga0075430_100006072
175 Ga0075430_100165882
176 Ga0075431_100090812
177 Ga0075431_100619298
178 Ga0068865_101548845
179 Ga0105250_10011093
180 Ga0105240_10184475
181 Ga0105245_10768144
182 Ga0114129_10098784
183 Ga0114129_11712658
184 Ga0105243_10635022
185 Ga0105241_10167945
186 Ga0105249_10125151
187 Ga0105239_11994553
188 Ga0105246_11091546
189 Ga0157369_12293040
190 Ga0163162_10275096
191 Ga0157375_12097466
192 Ga0209147_100057
193 Ga0209025_1001084
194 Ga0207655_1005090
195 Ga0207699_10632923
196 Ga0207654_10937518
197 Ga0207664_11211568
198 Ga0207704_10316922
199 Ga0207679_10836288
200 Ga0207712_10905337
201 Ga0207668_10014649
202 Ga0207708_10346982
203 Ga0207674_10195105
204 Ga0268265_11454813
205 Ga0307517_10298216
206 Ga0307515_10000024
207 Ga0307515_10125561
208 Ga0307512_10157962
209 Ga0307513_10251269
210 Ga0307509_10231294
211 Ga0307516_10010944
212 Ga0307405_10035397
213 Ga0307413_10057612
214 Ga0307413_10074671
215 Ga0307410_10187495
216 Ga0307410_11393490
217 Ga0307406_10039378
218 Ga0307407_10082720
219 Ga0307407_10171785
220 Ga0307407_10944964
221 Ga0307412_10094308
222 Ga0307409_100023455
223 Ga0307416_100191932
224 Ga0307416_101552477
225 Ga0307416_102768205
226 Ga0307414_10197471
227 Ga0307411_10073914
228 Ga0307411_10182205
229 Ga0307415_100173249
230 Ga0307415_100346646
231 Ga0307415_100549454
232 Ga0307507_10178935
233 Ga0395900_0020882
234 Ga0395900_0580287
235 Ga0395898_0037248
236 Ga0395898_0999707
237 Ga0395905_0020331
238 Ga0395905_1686095
239 Ga0395901_0013334
240 Ga0395901_0182493
241 Ga0395901_1427016
242 Ga0451787_466336
243 Ga0451807_0523929
244 Ga0451807_1247116
245 Ga0451833_1046462
246 Ga0451839_0695134
247 Ga0451841_0217039
248 Ga0451843_0506271
249 Ga0451855_0194006
250 Ga0451853_2518171
251 Ga0439448_0157583
252 Ga0466972_0048199
253 Ga0466972_0075857
254 Ga0466970_0265523
255 Ga0495641_0115967
256 Ga0495650_0006539
257 Ga0495596_0289639
258 Ga0495668_0000624
259 Ga0495625_0278908
260 Ga0496114_0170150
261 Ga0501269_000498
262 nmdc:mga03n38_142950_c1
263 nmdc:mga06z11_452175_c1
264 nmdc:mga09592_1400721_c1
265 nmdc:mga09592_548975_c1
266 nmdc:mga0qj67_4486_c1
267 nmdc:mga0qj67_559510_c1
268 nmdc:mga06r32_100738_c1
269 nmdc:mga06r32_27456_c1
270 nmdc:mga0n895_1907928_c1
271 nmdc:mga0n895_28928_c1
272 nmdc:mga0a205_979551_c1
273 Ga0500642_0040544
274 Ga0500655_076698
275 Ga0500568_0102457
276 Ga0500616_0000012
277 Ga0500616_0001380
278 Ga0500570_051614
279 Ga0500645_096618
280 2738695787
281 2739326069
282 2739605090
283 2760623408
284 2808902201
285 2809028296
286 2857466376
287 2956902163
288 2966603467
289 2979089336
290 2997452218
291 8022795675
292 8057583951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

124

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kjz-assembly1.cif.gz_B solution nmr structure of protein atc0852 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att2. 0.8143 2 117
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7989 5 125
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.7958 1 117
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.7944 6 118
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.7893 2 120
ID Description Score Start End Superfamily
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.889 1 52 3.30.720.120
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.87 2 55 3.30.720.120
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8424 2 55 3.30.720.120
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8294 1 52 3.30.720.120
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8033 67 117 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A4V3SY40-F1-model_v4 VOC family protein 0.9988 2 128
AF-A0A372FCU1-F1-model_v4 VOC family protein 0.9954 2 130
AF-C2SKZ2-F1-model_v4 deleted 0.9934 2 133
AF-A0A429T2J1-F1-model_v4 deleted 0.9918 1 129
AF-A0A562V3J3-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9903 1 130 GO:0016829

Map