F197622

General Info

Members Datasets Scaffolds Average Seq Length
146 86 143 105

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_11133263|Ga0157380_111332632
Length 114
Sequence MLKGLGQLGDMAKIMKQAQEMQSRMXXXQNRLDEIEVTGEAGAGLVKVTASAKGAVQRLTIDPSLFVPEEREVVEDLIVAAVQDAQARAMVAAQAEMAKVTEGMDLPPGLKLPF

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
10 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
11 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
12 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
13 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
16 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
17 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
18 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
27 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
29 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
30 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
31 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
34 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
35 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
36 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
37 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
38 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
39 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
42 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
44 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
47 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
48 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
49 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
52 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
64 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
65 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
69 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
70 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
71 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
76 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
77 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
78 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
79 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
80 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
81 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
82 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
83 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
84 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
85 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
86 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 3.42
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 4.11
Rhizosphere 89.04
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1029645 3300000546 Bacteria 588
2 Ga0070680_100002727 3300005336 Bacteria 13099
3 Ga0070711_101933496 3300005439 Bacteria 518
4 Ga0070696_100001239 3300005546 Bacteria 16574
5 Ga0068855_100033795 3300005563 Bacteria 6101
6 Ga0070716_100071756 3300006173 Bacteria 2037
7 Ga0070716_101432259 3300006173 Bacteria 563
8 Ga0070712_100132544 3300006175 Bacteria 1891
9 Ga0075366_10001651 3300006195 Bacteria 11205
10 Ga0099794_10081574 3300007265 Bacteria 1596
11 Ga0099794_10323488 3300007265 Bacteria 800
12 Ga0099794_10550446 3300007265 Bacteria 609
13 Ga0099795_10002671 3300007788 Bacteria 4251
14 Ga0105240_10000348 3300009093 Bacteria 86596
15 Ga0105240_10000784 3300009093 Bacteria 57586
16 Ga0105240_10085211 3300009093 Bacteria 3872
17 Ga0099796_10004968 3300010159 Bacteria 3276
18 Ga0163162_12437270 3300013306 Unclassified 601
19 Ga0157380_11133263 3300014326 Bacteria 823
20 Ga0207695_10000853 3300025913 Bacteria 55861
21 Ga0207695_10002965 3300025913 Bacteria 24484
22 Ga0207695_10455061 3300025913 Bacteria 1163
23 Ga0207693_10187633 3300025915 Bacteria 1627
24 Ga0207700_10498335 3300025928 Bacteria 1078
25 Ga0207665_10880841 3300025939 Bacteria 710
26 Ga0207667_10135919 3300025949 Bacteria 2532
27 Ga0209179_1001491 3300027512 Bacteria 2885
28 Ga0209588_1055590 3300027671 Bacteria 1279
29 Ga0209971_1155761 3300027682 Bacteria 563
30 Ga0265357_1014552 3300028023 Bacteria 826
31 Ga0265760_10196805 3300031090 Bacteria 679
32 Ga0265340_10103331 3300031247 Bacteria 1323
33 Ga0265339_10367413 3300031249 Bacteria 676
34 Ga0265316_10018991 3300031344 Bacteria 5897
35 Ga0265316_10292801 3300031344 Bacteria 1187
36 Ga0307509_10000033 3300031507 Bacteria 194363
37 Ga0307408_102431763 3300031548 Bacteria 509
38 Ga0265313_10216876 3300031595 Bacteria 790
39 Ga0265313_10363612 3300031595 Bacteria 572
40 Ga0307508_10118973 3300031616 Bacteria 2244
41 Ga0316575_10000798 3300031665 Bacteria 9549
42 Ga0316575_10010632 3300031665 Bacteria 3389
43 Ga0316579_10029089 3300031691 Bacteria 2520
44 Ga0316576_10305064 3300031727 Bacteria 1189
45 Ga0316578_10043682 3300031728 Bacteria 2604
46 Ga0316578_10237786 3300031728 Bacteria 1094
47 Ga0316578_10381697 3300031728 Bacteria 836
48 Ga0316578_10645784 3300031728 Bacteria 618
49 Ga0316577_10400210 3300031733 Bacteria 780
50 Ga0307415_102185020 3300032126 Bacteria 541
51 Ga0316580_10054459 3300032139 Bacteria 1231
52 Ga0316593_10020184 3300032168 Bacteria 2068
53 Ga0316593_10063512 3300032168 Bacteria 1266
54 Ga0307510_10224220 3300033180 Bacteria 1388
55 Ga0316592_1045551 3300033524 Bacteria 976
56 Ga0316596_1001783 3300033541 Bacteria 4473
57 Ga0373934_0500610 3300035086 Bacteria 511
58 Ga0373936_0047028 3300035113 Bacteria 1740
59 Ga0373954_0143883 3300035118 Bacteria 1164
60 Ga0373946_0093896 3300035171 Bacteria 1334
61 Ga0316574_0005232 3300035398 Bacteria 6902
62 Ga0316574_0006192 3300035398 Bacteria 6444
63 Ga0316574_0010852 3300035398 Bacteria 5161
64 Ga0316574_0053640 3300035398 Bacteria 2517
65 Ga0316574_0098668 3300035398 Bacteria 1868
66 Ga0316574_0397539 3300035398 Bacteria 868
67 Ga0373924_0532932 3300035410 Bacteria 528
68 Ga0373935_0629225 3300035692 Bacteria 786
69 Ga0373935_0687730 3300035692 Bacteria 752
70 Ga0373935_1072436 3300035692 Bacteria 599
71 Ga0373927_0511165 3300035695 Bacteria 794
72 Ga0373937_1010204 3300036401 Bacteria 780
73 Ga0316582_0044125 3300036647 Bacteria 2801
74 Ga0316582_0061209 3300036647 Bacteria 2415
75 Ga0316582_0077166 3300036647 Bacteria 2168
76 Ga0316582_0198041 3300036647 Bacteria 1370
77 Ga0316584_0020575 3300036712 Bacteria 4786
78 Ga0316584_0032017 3300036712 Bacteria 3890
79 Ga0316584_0230407 3300036712 Bacteria 1358
80 Ga0316584_0414789 3300036712 Bacteria 957
81 Ga0316584_0422131 3300036712 Bacteria 947
82 Ga0316584_0492131 3300036712 Bacteria 863
83 Ga0316584_0660806 3300036712 Bacteria 720
84 Ga0373925_0516984 3300037068 Bacteria 981
85 Ga0373925_0575654 3300037068 Bacteria 927
86 Ga0316581_0162272 3300037588 Bacteria 689
87 Ga0451577_0031554 3300042876 Bacteria 4780
88 Ga0451577_0043640 3300042876 Bacteria 4017
89 Ga0451577_0178849 3300042876 Bacteria 1912
90 Ga0451577_0499293 3300042876 Bacteria 1105
91 Ga0451577_0501101 3300042876 Bacteria 1102
92 Ga0451577_1091085 3300042876 Bacteria 715
93 Ga0453683_0078307 3300044673 Bacteria 2070
94 Ga0453683_0276890 3300044673 Bacteria 1071
95 Ga0453683_0305821 3300044673 Bacteria 1017
96 Ga0453683_0677559 3300044673 Bacteria 675
97 Ga0453684_0000005 3300044712 Bacteria 1431632
98 Ga0453684_0005767 3300044712 Bacteria 24180
99 Ga0453684_0022752 3300044712 Bacteria 9280
100 Ga0453684_0034070 3300044712 Bacteria 7080
101 Ga0453684_0060236 3300044712 Bacteria 4886
102 Ga0453684_0128503 3300044712 Bacteria 3045
103 Ga0453684_0511323 3300044712 Bacteria 1328
104 Ga0453684_0795817 3300044712 Bacteria 1020
105 Ga0451576_0000266 3300045051 Bacteria 127813
106 Ga0451576_0000745 3300045051 Bacteria 64985
107 Ga0451576_0026468 3300045051 Bacteria 6240
108 Ga0451576_0038763 3300045051 Bacteria 5043
109 Ga0451576_0075477 3300045051 Bacteria 3508
110 Ga0451576_0096029 3300045051 Bacteria 3083
111 Ga0451576_0107472 3300045051 Bacteria 2903
112 Ga0451576_0111033 3300045051 Bacteria 2853
113 Ga0451576_0134486 3300045051 Bacteria 2578
114 Ga0451576_0175993 3300045051 Bacteria 2234
115 Ga0451576_0483022 3300045051 Bacteria 1301
116 Ga0451576_0516265 3300045051 Bacteria 1255
117 Ga0451576_0753875 3300045051 Bacteria 1022
118 Ga0451576_1324943 3300045051 Bacteria 750
119 Ga0495628_0331372 3300046516 Bacteria 1122
120 Ga0495647_0078197 3300046681 Bacteria 1337
121 Ga0496101_0078687 3300048904 Bacteria 2433
122 Ga0496104_0016639 3300048907 Bacteria 6684
123 Ga0496105_0223459 3300048908 Bacteria 1532
124 Ga0496107_0114719 3300048910 Bacteria 1982
125 Ga0496114_0081220 3300048917 Bacteria 2738
126 Ga0496115_0080714 3300048918 Bacteria 2648
127 Ga0501290_009604 3300049513 Bacteria 1232
128 Ga0501034_0353640 3300049571 Bacteria 1397
129 Ga0501039_0181175 3300049575 Bacteria 1657
130 Ga0501046_1246034 3300049580 Bacteria 510
131 Ga0501068_0610575 3300049584 Bacteria 711
132 Ga0501071_0548024 3300049587 Bacteria 888
133 Ga0501075_0935115 3300049591 Bacteria 659
134 Ga0501079_0526916 3300049741 Bacteria 929
135 Ga0501081_1105924 3300049743 Bacteria 600
136 Ga0501081_1413173 3300049743 Bacteria 528
137 Ga0501280_000536 3300049776 Bacteria 8902
138 Ga0501045_0497886 3300049824 Bacteria 905
139 nmdc:mga0k408_3881_c1 3300050493 Bacteria 7923
140 Ga0500607_047223 3300053121 Bacteria 2305
141 Ga0500559_0092944 3300053136 Bacteria 1383
142 Ga0500636_0001666 3300053177 Bacteria 12165
143 Ga0530510_0655954 3300061734 Bacteria 799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0053640 Ga0316574_0053640_1864_2187 86
2 3300049824 Ga0501045_0497886 Ga0501045_0497886_122_466 88
3 3300009093 Ga0105240_10000348 Ga0105240_1000034876 91
4 3300025913 Ga0207695_10000853 Ga0207695_100008532 91
5 3300046516 Ga0495628_0331372 Ga0495628_0331372_15_296 93
6 3300027682 Ga0209971_1155761 Ga0209971_11557612 94
7 3300032168 Ga0316593_10020184 Ga0316593_100201842 94
8 3300033524 Ga0316592_1045551 Ga0316592_10455512 94
9 3300033541 Ga0316596_1001783 Ga0316596_10017832 94
10 3300036712 Ga0316584_0032017 Ga0316584_0032017_1127_1450 94
11 3300031728 Ga0316578_10237786 Ga0316578_102377862 95
12 3300005563 Ga0068855_100033795 Ga0068855_1000337952 96
13 3300009093 Ga0105240_10000784 Ga0105240_1000078454 96
14 3300025913 Ga0207695_10002965 Ga0207695_100029654 96
15 3300025949 Ga0207667_10135919 Ga0207667_101359192 96
16 3300035398 Ga0316574_0397539 Ga0316574_0397539_408_752 97
17 3300036712 Ga0316584_0660806 Ga0316584_0660806_23_367 97
18 3300028023 Ga0265357_1014552 Ga0265357_10145522 98
19 3300031090 Ga0265760_10196805 Ga0265760_101968052 98
20 3300044673 Ga0453683_0677559 Ga0453683_0677559_12_308 98
21 3300050493 nmdc:mga0k408_3881_c1 nmdc:mga0k408_3881_c1_6223_6519 98
22 3300031727 Ga0316576_10305064 Ga0316576_103050642 99
23 3300031728 Ga0316578_10381697 Ga0316578_103816972 99
24 3300032139 Ga0316580_10054459 Ga0316580_100544592 99
25 3300035398 Ga0316574_0005232 Ga0316574_0005232_1487_1786 99
26 3300035398 Ga0316574_0010852 Ga0316574_0010852_1303_1602 99
27 3300035398 Ga0316574_0098668 Ga0316574_0098668_119_442 99
28 3300036647 Ga0316582_0044125 Ga0316582_0044125_601_900 99
29 3300036647 Ga0316582_0077166 Ga0316582_0077166_238_561 99
30 3300036712 Ga0316584_0020575 Ga0316584_0020575_3797_4096 99
31 3300036712 Ga0316584_0422131 Ga0316584_0422131_147_470 99
32 3300036712 Ga0316584_0492131 Ga0316584_0492131_128_427 99
33 3300049743 Ga0501081_1413173 Ga0501081_1413173_23_328 100
34 3300035113 Ga0373936_0047028 Ga0373936_0047028_691_1014 102
35 3300035692 Ga0373935_0687730 Ga0373935_0687730_65_388 102
36 iso_pu_bacteria 2526164512 2526213750 103
37 iso_pu_bacteria 2547132512 2548846829 103
38 iso_pu_bacteria 2881714928 2881716526 105
39 3300006173 Ga0070716_101432259 Ga0070716_1014322592 106
40 3300025939 Ga0207665_10880841 Ga0207665_108808412 106
41 3300031548 Ga0307408_102431763 Ga0307408_1024317632 106
42 3300031616 Ga0307508_10118973 Ga0307508_101189732 106
43 3300035692 Ga0373935_0629225 Ga0373935_0629225_390_719 106
44 3300035695 Ga0373927_0511165 Ga0373927_0511165_161_490 106
45 3300036647 Ga0316582_0061209 Ga0316582_0061209_1884_2204 106
46 3300037068 Ga0373925_0516984 Ga0373925_0516984_616_945 106
47 3300037588 Ga0316581_0162272 Ga0316581_0162272_308_628 106
48 3300042876 Ga0451577_1091085 Ga0451577_1091085_259_588 106
49 3300045051 Ga0451576_0111033 Ga0451576_0111033_1822_2151 106
50 3300049776 Ga0501280_000536 Ga0501280_000536_3352_3672 106
51 3300005336 Ga0070680_100002727 Ga0070680_1000027277 107
52 3300006195 Ga0075366_10001651 Ga0075366_100016517 107
53 3300025913 Ga0207695_10455061 Ga0207695_104550612 107
54 3300027671 Ga0209588_1055590 Ga0209588_10555902 107
55 3300031249 Ga0265339_10367413 Ga0265339_103674132 107
56 3300031344 Ga0265316_10018991 Ga0265316_100189912 107
57 3300031344 Ga0265316_10292801 Ga0265316_102928012 107
58 3300031507 Ga0307509_10000033 Ga0307509_10000033180 107
59 3300031595 Ga0265313_10363612 Ga0265313_103636122 107
60 3300031665 Ga0316575_10000798 Ga0316575_100007986 107
61 3300031665 Ga0316575_10010632 Ga0316575_100106322 107
62 3300031691 Ga0316579_10029089 Ga0316579_100290893 107
63 3300031728 Ga0316578_10043682 Ga0316578_100436824 107
64 3300031728 Ga0316578_10645784 Ga0316578_106457842 107
65 3300031733 Ga0316577_10400210 Ga0316577_104002102 107
66 3300032168 Ga0316593_10063512 Ga0316593_100635122 107
67 3300033180 Ga0307510_10224220 Ga0307510_102242202 107
68 3300035398 Ga0316574_0006192 Ga0316574_0006192_4363_4686 107
69 3300035410 Ga0373924_0532932 Ga0373924_0532932_57_380 107
70 3300036647 Ga0316582_0198041 Ga0316582_0198041_949_1272 107
71 3300036712 Ga0316584_0230407 Ga0316584_0230407_790_1113 107
72 3300036712 Ga0316584_0414789 Ga0316584_0414789_51_374 107
73 3300037068 Ga0373925_0575654 Ga0373925_0575654_475_798 107
74 3300042876 Ga0451577_0031554 Ga0451577_0031554_132_455 107
75 3300042876 Ga0451577_0043640 Ga0451577_0043640_2236_2559 107
76 3300042876 Ga0451577_0178849 Ga0451577_0178849_1136_1462 107
77 3300042876 Ga0451577_0499293 Ga0451577_0499293_114_437 107
78 3300042876 Ga0451577_0501101 Ga0451577_0501101_285_608 107
79 3300044673 Ga0453683_0078307 Ga0453683_0078307_1400_1726 107
80 3300044673 Ga0453683_0276890 Ga0453683_0276890_114_437 107
81 3300044673 Ga0453683_0305821 Ga0453683_0305821_378_701 107
82 3300044712 Ga0453684_0000005 Ga0453684_0000005_883913_884239 107
83 3300044712 Ga0453684_0005767 Ga0453684_0005767_22056_22379 107
84 3300044712 Ga0453684_0022752 Ga0453684_0022752_8537_8863 107
85 3300044712 Ga0453684_0034070 Ga0453684_0034070_625_951 107
86 3300044712 Ga0453684_0060236 Ga0453684_0060236_2367_2690 107
87 3300044712 Ga0453684_0128503 Ga0453684_0128503_145_471 107
88 3300044712 Ga0453684_0511323 Ga0453684_0511323_672_995 107
89 3300044712 Ga0453684_0795817 Ga0453684_0795817_344_670 107
90 3300045051 Ga0451576_0000266 Ga0451576_0000266_49401_49727 107
91 3300045051 Ga0451576_0000745 Ga0451576_0000745_61413_61736 107
92 3300045051 Ga0451576_0026468 Ga0451576_0026468_2372_2695 107
93 3300045051 Ga0451576_0038763 Ga0451576_0038763_2060_2383 107
94 3300045051 Ga0451576_0075477 Ga0451576_0075477_1236_1559 107
95 3300045051 Ga0451576_0096029 Ga0451576_0096029_1019_1342 107
96 3300045051 Ga0451576_0107472 Ga0451576_0107472_476_802 107
97 3300045051 Ga0451576_0134486 Ga0451576_0134486_616_942 107
98 3300045051 Ga0451576_0175993 Ga0451576_0175993_1346_1669 107
99 3300045051 Ga0451576_0483022 Ga0451576_0483022_805_1128 107
100 3300045051 Ga0451576_0516265 Ga0451576_0516265_447_773 107
101 3300045051 Ga0451576_0753875 Ga0451576_0753875_292_615 107
102 3300045051 Ga0451576_1324943 Ga0451576_1324943_286_609 107
103 3300046681 Ga0495647_0078197 Ga0495647_0078197_585_908 107
104 3300049513 Ga0501290_009604 Ga0501290_009604_727_1050 107
105 3300049587 Ga0501071_0548024 Ga0501071_0548024_109_432 107
106 3300053121 Ga0500607_047223 Ga0500607_047223_676_999 107
107 3300053136 Ga0500559_0092944 Ga0500559_0092944_527_850 107
108 3300053177 Ga0500636_0001666 Ga0500636_0001666_11775_12098 107
109 3300000546 LJNas_1029645 LJNas_10296452 108
110 3300005439 Ga0070711_101933496 Ga0070711_1019334962 108
111 3300005546 Ga0070696_100001239 Ga0070696_1000012392 108
112 3300006173 Ga0070716_100071756 Ga0070716_1000717562 108
113 3300006175 Ga0070712_100132544 Ga0070712_1001325442 108
114 3300007265 Ga0099794_10081574 Ga0099794_100815742 108
115 3300007265 Ga0099794_10323488 Ga0099794_103234882 108
116 3300007265 Ga0099794_10550446 Ga0099794_105504461 108
117 3300007788 Ga0099795_10002671 Ga0099795_100026715 108
118 3300009093 Ga0105240_10085211 Ga0105240_100852111 108
119 3300010159 Ga0099796_10004968 Ga0099796_100049682 108
120 3300013306 Ga0163162_12437270 Ga0163162_124372702 108
121 3300014326 Ga0157380_11133263 Ga0157380_111332632 108
122 3300025915 Ga0207693_10187633 Ga0207693_101876332 108
123 3300025928 Ga0207700_10498335 Ga0207700_104983351 108
124 3300027512 Ga0209179_1001491 Ga0209179_10014912 108
125 3300031247 Ga0265340_10103331 Ga0265340_101033312 108
126 3300031595 Ga0265313_10216876 Ga0265313_102168762 108
127 3300032126 Ga0307415_102185020 Ga0307415_1021850202 108
128 3300035086 Ga0373934_0500610 Ga0373934_0500610_156_482 108
129 3300035118 Ga0373954_0143883 Ga0373954_0143883_433_759 108
130 3300035171 Ga0373946_0093896 Ga0373946_0093896_378_704 108
131 3300035692 Ga0373935_1072436 Ga0373935_1072436_20_346 108
132 3300036401 Ga0373937_1010204 Ga0373937_1010204_194_520 108
133 3300048904 Ga0496101_0078687 Ga0496101_0078687_1966_2292 108
134 3300048907 Ga0496104_0016639 Ga0496104_0016639_4163_4489 108
135 3300048908 Ga0496105_0223459 Ga0496105_0223459_1132_1458 108
136 3300048910 Ga0496107_0114719 Ga0496107_0114719_1316_1642 108
137 3300048917 Ga0496114_0081220 Ga0496114_0081220_1083_1409 108
138 3300048918 Ga0496115_0080714 Ga0496115_0080714_193_519 108
139 3300049571 Ga0501034_0353640 Ga0501034_0353640_47_376 108
140 3300049575 Ga0501039_0181175 Ga0501039_0181175_1191_1535 108
141 3300049580 Ga0501046_1246034 Ga0501046_1246034_135_479 108
142 3300049584 Ga0501068_0610575 Ga0501068_0610575_52_396 108
143 3300049591 Ga0501075_0935115 Ga0501075_0935115_180_509 108
144 3300049741 Ga0501079_0526916 Ga0501079_0526916_50_394 108
145 3300049743 Ga0501081_1105924 Ga0501081_1105924_25_369 108
146 3300061734 Ga0530510_0655954 Ga0530510_0655954_250_594 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

15

105

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.9757 16 93
1pug-assembly1.cif.gz_B structure of e. coli ybab 0.966 20 89
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.9402 16 93
1pug-assembly2.cif.gz_D structure of e. coli ybab 0.9372 21 91
5yrx-assembly1.cif.gz_A-2 crystal structure of a hypothetical protein rv3716c from mycobacterium tuberculosis 0.9284 22 89
ID Description Score Start End Superfamily
1pugB00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.966 20 89 3.30.1310.10
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.9284 22 89 3.30.1310.10
af_P0A8B5_1_109_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.9223 3 108 3.30.1310.10
1pugB00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.9036 20 89 3.30.1310.10
af_P0A8B5_1_109_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8985 3 108 3.30.1310.10
ID Description Score Start End GO Terms
AF-A0A376VP66-F1-model_v4 Nucleoid-associated protein YbaB 0.9749 21 95 GO:0003677
GO:0005829
GO:0043590
AF-A0A1B6EV44-F1-model_v4 Nucleoid-associated protein 0.9665 8 92 GO:0003677
GO:0005829
AF-A0A2U8I590-F1-model_v4 Nucleoid-associated protein CCS41_00840 0.9644 8 108 GO:0003677
GO:0005829
GO:0043590
AF-A0A0A3B063-F1-model_v4 deleted 0.9626 3 108
AF-A0A660VBG8-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.9591 5 97 GO:0003677
GO:0005829

Feature Viewer

pLDDT pTM Quality
86.89 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map