F194091

General Info

Members Datasets Scaffolds Average Seq Length
145 100 290 360

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100102334|Ga0070686_1001023342
Length 410
Sequence MRTKVSEGEDAVTVVACIVSNRRLPSHALRASISPMSRKSRRRKSPQDIKIHRRSQPGAPPGVVIADPDQPKPVIHAIVYGPAGIIDKALVSPEEAHALIGQQAVAWINVEGLGDADVIERFGELFGLHRLALEDTVNVHQRAKVEDYGEVLFIVLRMIHCGEASRHRCGTEQISIFVGTSWVLTFQEGHPGDSFDRVRARIREGSGRMRQLGTDYLAYTLIDAVIDNYYPVLEVYAERLDELEELVIEPRGARVIDDLHEVKADLLVLRRGIWPLRDAIALLARDDNPRIGDNTRLYLRDCYDHVVQVVDLVETYRELTADLRDLYMSSISNRINETMRVLTIISTIFIPLTFIAGIYGMNFDYAASPLNMPELHWTFGYPLALIMMAITTVGMVAYFYRQGWIFRSLK

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
52 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
53 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
58 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
59 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
60 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
77 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
86 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
87 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
99 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
100 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 0.69
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100102334 3300005544 Bacteria 1937
2 JGI25406J46586_10012174 3300003203 Bacteria 3742
3 rootL2_10018644 3300003322 Bacteria 4285
4 Ga0068868_100060049 3300005338 Bacteria 3009
5 Ga0070689_100035055 3300005340 Unclassified 3832
6 Ga0070669_100000210 3300005353 Bacteria 48796
7 Ga0070688_100001851 3300005365 Bacteria 10626
8 Ga0070700_100219024 3300005441 Bacteria 1347
9 Ga0070685_10012165 3300005466 Bacteria 4515
10 Ga0070706_100009797 3300005467 Bacteria 8907
11 Ga0070706_100066677 3300005467 Bacteria 3329
12 Ga0070707_100334242 3300005468 Bacteria 1472
13 Ga0070699_100025816 3300005518 Bacteria 5063
14 Ga0070697_100154136 3300005536 Bacteria 1938
15 Ga0070665_100002026 3300005548 Bacteria 22783
16 Ga0068857_100358912 3300005577 Bacteria 1351
17 Ga0068856_100123121 3300005614 Bacteria 2596
18 Ga0068859_100054052 3300005617 Bacteria 4039
19 Ga0068859_100055235 3300005617 Bacteria 3996
20 Ga0068863_100039810 3300005841 Bacteria 4470
21 Ga0081539_10000278 3300005985 Bacteria 116557
22 Ga0075428_100006344 3300006844 Bacteria 13157
23 Ga0075428_100007717 3300006844 Bacteria 11922
24 Ga0075428_100142176 3300006844 Archaea 2609
25 Ga0075428_100355678 3300006844 Bacteria 1571
26 Ga0075431_100224313 3300006847 Bacteria 1916
27 Ga0075433_10250563 3300006852 Unclassified 1571
28 Ga0075434_100010948 3300006871 Bacteria 8530
29 Ga0075436_100010911 3300006914 Bacteria 6235
30 Ga0075436_100155794 3300006914 Bacteria 1609
31 Ga0097620_100054052 3300006931 Bacteria 4039
32 Ga0097620_100055238 3300006931 Bacteria 3996
33 Ga0111539_10116227 3300009094 Bacteria 3137
34 Ga0111539_10247268 3300009094 Bacteria 2076
35 Ga0111539_10272220 3300009094 Bacteria 1971
36 Ga0114129_10188486 3300009147 Unclassified 2802
37 Ga0105237_10467501 3300009545 Bacteria 1267
38 Ga0105249_10005988 3300009553 Bacteria 10540
39 Ga0105249_10096217 3300009553 Bacteria 2777
40 Ga0105239_10660128 3300010375 Bacteria 1195
41 Ga0105246_10286040 3300011119 Bacteria 1325
42 Ga0157374_10360512 3300013296 Bacteria 1446
43 Ga0157378_10410909 3300013297 Unclassified 1336
44 Ga0213872_10049567 3300021361 Bacteria 1907
45 Ga0213872_10094300 3300021361 Bacteria 1337
46 Ga0213874_10017261 3300021377 Bacteria 1933
47 Ga0207699_10113013 3300025906 Bacteria 1744
48 Ga0207684_10006363 3300025910 Bacteria 10764
49 Ga0207684_10048602 3300025910 Bacteria 3597
50 Ga0207681_10000027 3300025923 Bacteria 190164
51 Ga0207700_10002728 3300025928 Bacteria 10181
52 Ga0207686_10034025 3300025934 Bacteria 3047
53 Ga0207668_10114496 3300025972 Bacteria 2030
54 Ga0207708_10026999 3300026075 Bacteria 4347
55 Ga0207702_10092485 3300026078 Bacteria 2651
56 Ga0207641_10017397 3300026088 Bacteria 5886
57 Ga0207674_10098207 3300026116 Bacteria 2912
58 Ga0268266_10000684 3300028379 Bacteria 45767
59 Ga0265337_1018154 3300028556 Bacteria 2240
60 Ga0265327_10013593 3300031251 Bacteria 5398
61 Ga0316575_10011474 3300031665 Bacteria 3282
62 Ga0316579_10003225 3300031691 Bacteria 6317
63 Ga0316579_10011240 3300031691 Bacteria 3801
64 Ga0316576_10018251 3300031727 Bacteria 4786
65 Ga0316576_10052798 3300031727 Unclassified 2960
66 Ga0316576_10073973 3300031727 Bacteria 2518
67 Ga0316578_10018114 3300031728 Bacteria 3850
68 Ga0316578_10084561 3300031728 Bacteria 1890
69 Ga0316577_10008179 3300031733 Bacteria 5597
70 Ga0316577_10064602 3300031733 Bacteria 2042
71 Ga0307406_10027278 3300031901 Bacteria 3440
72 Ga0307412_10035999 3300031911 Bacteria 3167
73 Ga0307414_10000082 3300032004 Bacteria 87561
74 Ga0316580_10001875 3300032139 Bacteria 5641
75 Ga0373929_0000002 3300035085 Bacteria 683932
76 Ga0373961_0000774 3300035241 Bacteria 10978
77 Ga0316574_0012289 3300035398 Bacteria 4895
78 Ga0316582_0056142 3300036647 Bacteria 2511
79 Ga0316582_0070632 3300036647 Bacteria 2259
80 Ga0316584_0027912 3300036712 Bacteria 4157
81 Ga0316584_0147972 3300036712 Bacteria 1749
82 Ga0316584_0171006 3300036712 Bacteria 1612
83 Ga0316584_0234903 3300036712 Bacteria 1343
84 Ga0395905_0000001 3300037471 Bacteria 2037079
85 Ga0436364_0067841 3300037853 Bacteria 1499
86 Ga0436364_0318884 3300037853 Bacteria 2020
87 Ga0436360_0143436 3300039438 Bacteria 5556
88 Ga0436360_0432768 3300039438 Unclassified 1834
89 Ga0436360_0553329 3300039438 Bacteria 2732
90 Ga0436361_0169643 3300039447 Bacteria 15399
91 Ga0436361_0262918 3300039447 Unclassified 1745
92 Ga0436361_0375569 3300039447 Bacteria 6751
93 Ga0436361_0413166 3300039447 Unclassified 2621
94 Ga0436361_0439600 3300039447 Unclassified 3653
95 Ga0436361_0456417 3300039447 Bacteria 3190
96 Ga0436361_0816331 3300039447 Bacteria 1259
97 Ga0436363_0091131 3300039450 Bacteria 4134
98 Ga0436363_0689248 3300039450 Bacteria 2044
99 Ga0436362_0629413 3300039453 Bacteria 4765
100 Ga0436362_1165293 3300039453 Bacteria 2748
101 Ga0451807_1668200 3300041486 Bacteria 2658
102 Ga0451577_0043928 3300042876 Bacteria 4001
103 Ga0453683_0002061 3300044673 Bacteria 16097
104 Ga0453683_0017226 3300044673 Bacteria 4654
105 Ga0466963_0053289 3300044694 Bacteria 2686
106 Ga0453684_0023044 3300044712 Bacteria 9199
107 Ga0453684_0057493 3300044712 Bacteria 5033
108 Ga0453684_0079604 3300044712 Bacteria 4096
109 Ga0451576_0014609 3300045051 Bacteria 8727
110 Ga0451576_0053362 3300045051 Bacteria 4235
111 Ga0495628_0069353 3300046516 Bacteria 2750
112 Ga0495658_0132598 3300046683 Bacteria 1518
113 Ga0495674_0031578 3300047319 Bacteria 4811
114 Ga0501034_0006766 3300049571 Bacteria 12263
115 Ga0501034_0016372 3300049571 Bacteria 7611
116 Ga0501034_0037000 3300049571 Bacteria 4942
117 Ga0501034_0129931 3300049571 Unclassified 2502
118 Ga0501034_0156308 3300049571 Bacteria 2254
119 Ga0501037_0082476 3300049573 Bacteria 2330
120 Ga0501043_0115372 3300049579 Bacteria 2108
121 Ga0501047_0000693 3300049581 Bacteria 35200
122 Ga0501067_0055083 3300049583 Bacteria 2203
123 Ga0501068_0053831 3300049584 Bacteria 2437
124 Ga0501075_0010726 3300049591 Bacteria 6451
125 Ga0501075_0199462 3300049591 Bacteria 1526
126 Ga0501077_0002384 3300049593 Bacteria 11281
127 Ga0501080_0014326 3300049742 Bacteria 7301
128 Ga0501081_0113593 3300049743 Bacteria 1924
129 Ga0501081_0165570 3300049743 Bacteria 1595
130 Ga0501035_0001002 3300049822 Bacteria 29849
131 Ga0501044_0001167 3300049823 Bacteria 31129
132 Ga0501044_0065646 3300049823 Bacteria 3701
133 nmdc:mga06z11_36268_c1 3300050494 Bacteria 2433
134 nmdc:mga05p37_367565_c1 3300050507 Unclassified 1689
135 nmdc:mga09592_93549_c1 3300050508 Unclassified 2570
136 nmdc:mga0qj67_72265_c1 3300050509 Bacteria 2754
137 nmdc:mga06r32_375713_c1 3300050510 Bacteria 1404
138 nmdc:mga06r32_410716_c1 3300050510 Bacteria 1335
139 nmdc:mga08y16_215496_c1 3300050511 Bacteria 1988
140 nmdc:mga0n895_106211_c1 3300050512 Bacteria 2821
141 nmdc:mga0n895_3075_c1 3300050512 Bacteria 13276
142 nmdc:mga0a205_96414_c1 3300050515 Unclassified 2856
143 Ga0501082_0000539 3300060353 Bacteria 33639
144 2884635497 2884634485 Bacteria 3928637
145 2919693642 2919692658 Bacteria 5943958
146 Ga0070686_100102334
147 JGI25406J46586_10012174
148 rootL2_10018644
149 Ga0068868_100060049
150 Ga0070689_100035055
151 Ga0070669_100000210
152 Ga0070688_100001851
153 Ga0070700_100219024
154 Ga0070685_10012165
155 Ga0070706_100009797
156 Ga0070706_100066677
157 Ga0070707_100334242
158 Ga0070699_100025816
159 Ga0070697_100154136
160 Ga0070665_100002026
161 Ga0068857_100358912
162 Ga0068856_100123121
163 Ga0068859_100054052
164 Ga0068859_100055235
165 Ga0068863_100039810
166 Ga0081539_10000278
167 Ga0075428_100006344
168 Ga0075428_100007717
169 Ga0075428_100142176
170 Ga0075428_100355678
171 Ga0075431_100224313
172 Ga0075433_10250563
173 Ga0075434_100010948
174 Ga0075436_100010911
175 Ga0075436_100155794
176 Ga0097620_100054052
177 Ga0097620_100055238
178 Ga0111539_10116227
179 Ga0111539_10247268
180 Ga0111539_10272220
181 Ga0114129_10188486
182 Ga0105237_10467501
183 Ga0105249_10005988
184 Ga0105249_10096217
185 Ga0105239_10660128
186 Ga0105246_10286040
187 Ga0157374_10360512
188 Ga0157378_10410909
189 Ga0213872_10049567
190 Ga0213872_10094300
191 Ga0213874_10017261
192 Ga0207699_10113013
193 Ga0207684_10006363
194 Ga0207684_10048602
195 Ga0207681_10000027
196 Ga0207700_10002728
197 Ga0207686_10034025
198 Ga0207668_10114496
199 Ga0207708_10026999
200 Ga0207702_10092485
201 Ga0207641_10017397
202 Ga0207674_10098207
203 Ga0268266_10000684
204 Ga0265337_1018154
205 Ga0265327_10013593
206 Ga0316575_10011474
207 Ga0316579_10003225
208 Ga0316579_10011240
209 Ga0316576_10018251
210 Ga0316576_10052798
211 Ga0316576_10073973
212 Ga0316578_10018114
213 Ga0316578_10084561
214 Ga0316577_10008179
215 Ga0316577_10064602
216 Ga0307406_10027278
217 Ga0307412_10035999
218 Ga0307414_10000082
219 Ga0316580_10001875
220 Ga0373929_0000002
221 Ga0373961_0000774
222 Ga0316574_0012289
223 Ga0316582_0056142
224 Ga0316582_0070632
225 Ga0316584_0027912
226 Ga0316584_0147972
227 Ga0316584_0171006
228 Ga0316584_0234903
229 Ga0395905_0000001
230 Ga0436364_0067841
231 Ga0436364_0318884
232 Ga0436360_0143436
233 Ga0436360_0432768
234 Ga0436360_0553329
235 Ga0436361_0169643
236 Ga0436361_0262918
237 Ga0436361_0375569
238 Ga0436361_0413166
239 Ga0436361_0439600
240 Ga0436361_0456417
241 Ga0436361_0816331
242 Ga0436363_0091131
243 Ga0436363_0689248
244 Ga0436362_0629413
245 Ga0436362_1165293
246 Ga0451807_1668200
247 Ga0451577_0043928
248 Ga0453683_0002061
249 Ga0453683_0017226
250 Ga0466963_0053289
251 Ga0453684_0023044
252 Ga0453684_0057493
253 Ga0453684_0079604
254 Ga0451576_0014609
255 Ga0451576_0053362
256 Ga0495628_0069353
257 Ga0495658_0132598
258 Ga0495674_0031578
259 Ga0501034_0006766
260 Ga0501034_0016372
261 Ga0501034_0037000
262 Ga0501034_0129931
263 Ga0501034_0156308
264 Ga0501037_0082476
265 Ga0501043_0115372
266 Ga0501047_0000693
267 Ga0501067_0055083
268 Ga0501068_0053831
269 Ga0501075_0010726
270 Ga0501075_0199462
271 Ga0501077_0002384
272 Ga0501080_0014326
273 Ga0501081_0113593
274 Ga0501081_0165570
275 Ga0501035_0001002
276 Ga0501044_0001167
277 Ga0501044_0065646
278 nmdc:mga06z11_36268_c1
279 nmdc:mga05p37_367565_c1
280 nmdc:mga09592_93549_c1
281 nmdc:mga0qj67_72265_c1
282 nmdc:mga06r32_375713_c1
283 nmdc:mga06r32_410716_c1
284 nmdc:mga08y16_215496_c1
285 nmdc:mga0n895_106211_c1
286 nmdc:mga0n895_3075_c1
287 nmdc:mga0a205_96414_c1
288 Ga0501082_0000539
289 2884635497
290 2919693642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01544

CorA

CorA-like Mg2+ transporter protein

102

401

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jtg-assembly1.cif.gz_C crystal structure of thermotoga maritima mutant d89k/d253k 0.9475 27 360
4eeb-assembly1.cif.gz_B cora coiled-coil mutant under mg2+ absence 0.9424 37 361
4eeb-assembly1.cif.gz_C cora coiled-coil mutant under mg2+ absence 0.9412 37 361
2iub-assembly1.cif.gz_C crystal structure of a divalent metal ion transporter cora at 2.9 a resolution. 0.9383 19 361
5jtg-assembly1.cif.gz_E crystal structure of thermotoga maritima mutant d89k/d253k 0.9377 27 361
ID Description Score Start End Superfamily
4i0uJ02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9483 167 280 1.20.58.340
5jtgD02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9457 166 280 1.20.58.340
4ev6D02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9453 175 299 1.20.58.340
2iubA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9441 166 280 1.20.58.340
4i0uI02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9441 166 280 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A353ZCX7-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9773 21 124
AF-A0A353ZCX7-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9592 21 124
AF-A0A7W1JQA1-F1-model_v4 Magnesium transport protein CorA 0.9555 18 366 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A090WT37-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9552 20 243 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A2W5EI72-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9535 36 271 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897

Map