F193239
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 144 | 108 | 288 | 218 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2922554459|2922556735 |
| Length | 248 |
| Sequence | IAATSSEPELTTGRVPAVLSFFGRASVSKVTAPMGKALVKTGLTPDSVTVIGTVASVAGAVTLFPSGHLFWGTLFIWFFVMFDMLDGAMARARGGGTRYGAVLDATCDRVADGAIFAGLAWWAVYHENSKWLLVATLICLVTSQVISYAKARAEASGLTADGGWIERPDRLIIVLVGSGLTGMGLPWAIHIAMWVLAAGSVVTVFQRVLAVRNSPGARELLPIAPAASTVEGAAGTEGDPKPEGEAEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 2 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 6 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 7 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 8 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 9 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 10 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 11 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 13 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 14 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 15 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 16 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 17 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 20 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 21 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 22 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 30 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 31 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 32 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 33 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 34 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 35 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 36 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 37 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 38 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 39 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 40 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 41 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 42 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 43 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 44 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 45 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 46 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 47 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 48 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 49 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 54 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 55 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 56 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 57 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 58 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 59 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 60 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 61 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 62 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 63 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 64 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 65 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 66 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 67 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 68 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 69 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 70 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 71 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 72 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 73 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 74 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 75 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 76 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 77 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 78 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 79 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 80 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 81 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 82 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 83 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 84 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 85 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 86 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 87 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 88 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 89 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 90 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 91 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 92 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 93 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 94 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 95 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 96 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 97 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 98 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 99 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 100 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 101 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 102 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 103 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 104 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 105 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 106 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 107 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 108 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.08 |
| Metatranscriptomes | 0 |
| Isolates | 22.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.69 |
| Bulb | 0 |
| Endosphere | 18.06 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 63.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055540_1000065 | 3300003792 | Bacteria | 126812 |
| 2 | Ga0055540_1000951 | 3300003792 | Bacteria | 18813 |
| 3 | Ga0070667_100005427 | 3300005367 | Bacteria | 10654 |
| 4 | Ga0070714_100002007 | 3300005435 | Bacteria | 14885 |
| 5 | Ga0070714_100051834 | 3300005435 | Bacteria | 3499 |
| 6 | Ga0070714_100343368 | 3300005435 | Bacteria | 1401 |
| 7 | Ga0070713_100038923 | 3300005436 | Bacteria | 3856 |
| 8 | Ga0070713_100121905 | 3300005436 | Bacteria | 2288 |
| 9 | Ga0068853_100007909 | 3300005539 | Bacteria | 8526 |
| 10 | Ga0068853_100045670 | 3300005539 | Bacteria | 3753 |
| 11 | Ga0068854_100946166 | 3300005578 | Bacteria | 760 |
| 12 | Ga0068852_100013610 | 3300005616 | Bacteria | 6228 |
| 13 | Ga0075365_10091863 | 3300006038 | Bacteria | 2069 |
| 14 | Ga0075363_100128955 | 3300006048 | Bacteria | 1417 |
| 15 | Ga0075363_100291188 | 3300006048 | Bacteria | 946 |
| 16 | Ga0075364_10027071 | 3300006051 | Bacteria | 3660 |
| 17 | Ga0075364_10269636 | 3300006051 | Bacteria | 1158 |
| 18 | Ga0070716_100292486 | 3300006173 | Bacteria | 1129 |
| 19 | Ga0075362_10248228 | 3300006177 | Bacteria | 875 |
| 20 | Ga0075367_10283664 | 3300006178 | Bacteria | 1041 |
| 21 | Ga0075369_10012892 | 3300006186 | Bacteria | 3307 |
| 22 | Ga0075369_10120157 | 3300006186 | Bacteria | 1189 |
| 23 | Ga0075370_10018375 | 3300006353 | Bacteria | 3794 |
| 24 | Ga0105243_10014575 | 3300009148 | Bacteria | 5948 |
| 25 | Ga0105243_10398379 | 3300009148 | Bacteria | 1278 |
| 26 | Ga0105239_10564893 | 3300010375 | Bacteria | 1296 |
| 27 | Ga0157369_10205667 | 3300013105 | Bacteria | 2065 |
| 28 | Ga0213872_10121510 | 3300021361 | Bacteria | 1155 |
| 29 | Ga0213876_10056103 | 3300021384 | Bacteria | 2079 |
| 30 | Ga0209051_1004758 | 3300025303 | Bacteria | 8205 |
| 31 | Ga0207692_10058538 | 3300025898 | Bacteria | 1985 |
| 32 | Ga0207700_10032604 | 3300025928 | Bacteria | 3718 |
| 33 | Ga0207664_10012873 | 3300025929 | Bacteria | 5994 |
| 34 | Ga0207664_10042685 | 3300025929 | Bacteria | 3542 |
| 35 | Ga0207709_10003169 | 3300025935 | Bacteria | 9881 |
| 36 | Ga0207665_10309863 | 3300025939 | Bacteria | 1182 |
| 37 | Ga0207658_10045469 | 3300025986 | Bacteria | 3200 |
| 38 | Ga0207639_10015704 | 3300026041 | Bacteria | 5341 |
| 39 | Ga0265327_10000062 | 3300031251 | Bacteria | 234320 |
| 40 | Ga0265327_10000064 | 3300031251 | Bacteria | 231983 |
| 41 | Ga0265327_10005264 | 3300031251 | Bacteria | 10897 |
| 42 | Ga0307518_10170321 | 3300031838 | Bacteria | 1485 |
| 43 | Ga0307416_100718120 | 3300032002 | Bacteria | 1090 |
| 44 | Ga0373949_0104868 | 3300035090 | Bacteria | 778 |
| 45 | Ga0436364_0425919 | 3300037853 | Bacteria | 2311 |
| 46 | Ga0436365_1666845 | 3300039437 | Bacteria | 12280 |
| 47 | Ga0436361_0383263 | 3300039447 | Bacteria | 638 |
| 48 | Ga0436361_0931192 | 3300039447 | Bacteria | 891 |
| 49 | Ga0466969_0031028 | 3300044656 | Bacteria | 2722 |
| 50 | Ga0466969_0127302 | 3300044656 | Bacteria | 1183 |
| 51 | Ga0466965_0074397 | 3300044683 | Bacteria | 1712 |
| 52 | Ga0466965_0226776 | 3300044683 | Bacteria | 997 |
| 53 | Ga0466966_0004853 | 3300044684 | Bacteria | 8848 |
| 54 | Ga0466966_0089647 | 3300044684 | Bacteria | 1910 |
| 55 | Ga0466966_0111713 | 3300044684 | Bacteria | 1684 |
| 56 | Ga0466961_0011614 | 3300044693 | Bacteria | 5629 |
| 57 | Ga0466961_0064699 | 3300044693 | Bacteria | 2324 |
| 58 | Ga0466963_0005417 | 3300044694 | Bacteria | 7471 |
| 59 | Ga0466963_0279784 | 3300044694 | Bacteria | 1173 |
| 60 | Ga0466964_0067059 | 3300044706 | Bacteria | 1508 |
| 61 | Ga0466971_0007213 | 3300044719 | Bacteria | 4841 |
| 62 | Ga0466971_0285105 | 3300044719 | Bacteria | 791 |
| 63 | Ga0466968_0080655 | 3300044735 | Bacteria | 1429 |
| 64 | Ga0466970_0036303 | 3300044765 | Bacteria | 2611 |
| 65 | Ga0466970_0038610 | 3300044765 | Bacteria | 2533 |
| 66 | Ga0466970_0102380 | 3300044765 | Bacteria | 1560 |
| 67 | Ga0466957_0000944 | 3300044842 | Bacteria | 14885 |
| 68 | Ga0466957_0011746 | 3300044842 | Bacteria | 5061 |
| 69 | Ga0466957_0133415 | 3300044842 | Bacteria | 1594 |
| 70 | Ga0466959_0006765 | 3300045049 | Bacteria | 7986 |
| 71 | Ga0466959_0020538 | 3300045049 | Bacteria | 4868 |
| 72 | Ga0466959_0147504 | 3300045049 | Bacteria | 1659 |
| 73 | Ga0466958_0067266 | 3300045836 | Bacteria | 2188 |
| 74 | Ga0466958_0152428 | 3300045836 | Bacteria | 1458 |
| 75 | Ga0466958_0351379 | 3300045836 | Bacteria | 949 |
| 76 | Ga0466967_0062383 | 3300045976 | Bacteria | 3308 |
| 77 | Ga0466967_0123025 | 3300045976 | Bacteria | 2400 |
| 78 | Ga0466967_0209436 | 3300045976 | Bacteria | 1849 |
| 79 | Ga0495580_0127064 | 3300046472 | Bacteria | 1770 |
| 80 | Ga0495607_0037079 | 3300046501 | Bacteria | 2931 |
| 81 | Ga0495668_0001622 | 3300046616 | Bacteria | 21041 |
| 82 | Ga0495672_0032900 | 3300047320 | Bacteria | 3218 |
| 83 | Ga0495683_0000599 | 3300047323 | Bacteria | 27097 |
| 84 | Ga0496126_0045997 | 3300048929 | Bacteria | 4007 |
| 85 | Ga0496126_0278997 | 3300048929 | Bacteria | 1385 |
| 86 | Ga0496126_0385147 | 3300048929 | Bacteria | 1140 |
| 87 | Ga0501033_0033920 | 3300049570 | Bacteria | 3831 |
| 88 | Ga0501034_0023258 | 3300049571 | Bacteria | 6315 |
| 89 | Ga0501036_0105280 | 3300049572 | Bacteria | 2386 |
| 90 | Ga0501046_0301326 | 3300049580 | Bacteria | 1170 |
| 91 | Ga0501047_0034848 | 3300049581 | Bacteria | 4860 |
| 92 | Ga0501047_0080620 | 3300049581 | Bacteria | 3128 |
| 93 | Ga0501069_0025765 | 3300049585 | Bacteria | 3216 |
| 94 | Ga0501035_0001705 | 3300049822 | Bacteria | 22196 |
| 95 | Ga0501044_0028712 | 3300049823 | Bacteria | 5869 |
| 96 | Ga0501044_0117956 | 3300049823 | Bacteria | 2657 |
| 97 | nmdc:mga03n38_48872_c1 | 3300050490 | Bacteria | 1521 |
| 98 | nmdc:mga00v17_34386_c1 | 3300050491 | Bacteria | 3010 |
| 99 | nmdc:mga07m45_90171_c1 | 3300050496 | Bacteria | 1756 |
| 100 | nmdc:mga09592_133120_c1 | 3300050508 | Bacteria | 2140 |
| 101 | nmdc:mga0sz30_188412_c1 | 3300050516 | Bacteria | 916 |
| 102 | nmdc:mga0sz30_211616_c1 | 3300050516 | Bacteria | 861 |
| 103 | Ga0500635_0065579 | 3300053080 | Bacteria | 1277 |
| 104 | Ga0500643_007146 | 3300053087 | Bacteria | 4565 |
| 105 | Ga0500641_0199319 | 3300053096 | Bacteria | 855 |
| 106 | Ga0500652_018824 | 3300053131 | Bacteria | 2556 |
| 107 | Ga0500658_0023880 | 3300053134 | Bacteria | 2339 |
| 108 | Ga0500559_0072528 | 3300053136 | Bacteria | 1552 |
| 109 | Ga0500645_000171 | 3300053730 | Bacteria | 51112 |
| 110 | Ga0500645_087143 | 3300053730 | Bacteria | 887 |
| 111 | Ga0466962_0000231 | 3300061719 | Bacteria | 23213 |
| 112 | 2922556735 | 2922554459 | Bacteria | 6683962 |
| 113 | 2523382705 | 2523231044 | Bacteria | 6434991 |
| 114 | 2548696884 | 2547132424 | Bacteria | 8348532 |
| 115 | 2552109060 | 2551306166 | Bacteria | 9731570 |
| 116 | 2559424704 | 2558860280 | Bacteria | 11429938 |
| 117 | 2566995248 | 2565956761 | Bacteria | 6601618 |
| 118 | 2644512596 | 2643221692 | Bacteria | 7282860 |
| 119 | 2738705233 | 2738541274 | Bacteria | 6909446 |
| 120 | 2738892484 | 2738541308 | Bacteria | 7020677 |
| 121 | 2739205611 | 2738543005 | Bacteria | 5278128 |
| 122 | 2739237207 | 2738543011 | Bacteria | 5731169 |
| 123 | 2739334797 | 2738543028 | Bacteria | 6917070 |
| 124 | 2739361940 | 2738543034 | Bacteria | 6084756 |
| 125 | 2744954025 | 2744054611 | Bacteria | 5611514 |
| 126 | 2753035051 | 2751185725 | Bacteria | 5740550 |
| 127 | 2753323568 | 2751185792 | Bacteria | 5739090 |
| 128 | 2795782880 | 2795385470 | Bacteria | 8317180 |
| 129 | 2795796269 | 2795385472 | Bacteria | 6627535 |
| 130 | 2816510568 | 2816332139 | Bacteria | 9138787 |
| 131 | 2842891297 | 2842888712 | Bacteria | 4279094 |
| 132 | 2889301433 | 2889300758 | Bacteria | 5690814 |
| 133 | 2902801317 | 2902799365 | Bacteria | 5419524 |
| 134 | 2904539282 | 2904535858 | Bacteria | 6308016 |
| 135 | 2904769844 | 2904765812 | Bacteria | 5369154 |
| 136 | 2904771297 | 2904770941 | Bacteria | 5580202 |
| 137 | 2908816108 | 2908811453 | Bacteria | 5478616 |
| 138 | 2919423207 | 2919420072 | Bacteria | 5390363 |
| 139 | 2919435815 | 2919432681 | Bacteria | 5390474 |
| 140 | 2919717505 | 2919713450 | Bacteria | 7431245 |
| 141 | 2928144683 | 2928142448 | Bacteria | 5288925 |
| 142 | 2939749047 | 2939743619 | Bacteria | 5762299 |
| 143 | 2974317482 | 2974315732 | Bacteria | 4602776 |
| 144 | 2984525692 | 2984523437 | Bacteria | 4508481 |
| 145 | Ga0055540_1000065 | |||
| 146 | Ga0055540_1000951 | |||
| 147 | Ga0070667_100005427 | |||
| 148 | Ga0070714_100002007 | |||
| 149 | Ga0070714_100051834 | |||
| 150 | Ga0070714_100343368 | |||
| 151 | Ga0070713_100038923 | |||
| 152 | Ga0070713_100121905 | |||
| 153 | Ga0068853_100007909 | |||
| 154 | Ga0068853_100045670 | |||
| 155 | Ga0068854_100946166 | |||
| 156 | Ga0068852_100013610 | |||
| 157 | Ga0075365_10091863 | |||
| 158 | Ga0075363_100128955 | |||
| 159 | Ga0075363_100291188 | |||
| 160 | Ga0075364_10027071 | |||
| 161 | Ga0075364_10269636 | |||
| 162 | Ga0070716_100292486 | |||
| 163 | Ga0075362_10248228 | |||
| 164 | Ga0075367_10283664 | |||
| 165 | Ga0075369_10012892 | |||
| 166 | Ga0075369_10120157 | |||
| 167 | Ga0075370_10018375 | |||
| 168 | Ga0105243_10014575 | |||
| 169 | Ga0105243_10398379 | |||
| 170 | Ga0105239_10564893 | |||
| 171 | Ga0157369_10205667 | |||
| 172 | Ga0213872_10121510 | |||
| 173 | Ga0213876_10056103 | |||
| 174 | Ga0209051_1004758 | |||
| 175 | Ga0207692_10058538 | |||
| 176 | Ga0207700_10032604 | |||
| 177 | Ga0207664_10012873 | |||
| 178 | Ga0207664_10042685 | |||
| 179 | Ga0207709_10003169 | |||
| 180 | Ga0207665_10309863 | |||
| 181 | Ga0207658_10045469 | |||
| 182 | Ga0207639_10015704 | |||
| 183 | Ga0265327_10000062 | |||
| 184 | Ga0265327_10000064 | |||
| 185 | Ga0265327_10005264 | |||
| 186 | Ga0307518_10170321 | |||
| 187 | Ga0307416_100718120 | |||
| 188 | Ga0373949_0104868 | |||
| 189 | Ga0436364_0425919 | |||
| 190 | Ga0436365_1666845 | |||
| 191 | Ga0436361_0383263 | |||
| 192 | Ga0436361_0931192 | |||
| 193 | Ga0466969_0031028 | |||
| 194 | Ga0466969_0127302 | |||
| 195 | Ga0466965_0074397 | |||
| 196 | Ga0466965_0226776 | |||
| 197 | Ga0466966_0004853 | |||
| 198 | Ga0466966_0089647 | |||
| 199 | Ga0466966_0111713 | |||
| 200 | Ga0466961_0011614 | |||
| 201 | Ga0466961_0064699 | |||
| 202 | Ga0466963_0005417 | |||
| 203 | Ga0466963_0279784 | |||
| 204 | Ga0466964_0067059 | |||
| 205 | Ga0466971_0007213 | |||
| 206 | Ga0466971_0285105 | |||
| 207 | Ga0466968_0080655 | |||
| 208 | Ga0466970_0036303 | |||
| 209 | Ga0466970_0038610 | |||
| 210 | Ga0466970_0102380 | |||
| 211 | Ga0466957_0000944 | |||
| 212 | Ga0466957_0011746 | |||
| 213 | Ga0466957_0133415 | |||
| 214 | Ga0466959_0006765 | |||
| 215 | Ga0466959_0020538 | |||
| 216 | Ga0466959_0147504 | |||
| 217 | Ga0466958_0067266 | |||
| 218 | Ga0466958_0152428 | |||
| 219 | Ga0466958_0351379 | |||
| 220 | Ga0466967_0062383 | |||
| 221 | Ga0466967_0123025 | |||
| 222 | Ga0466967_0209436 | |||
| 223 | Ga0495580_0127064 | |||
| 224 | Ga0495607_0037079 | |||
| 225 | Ga0495668_0001622 | |||
| 226 | Ga0495672_0032900 | |||
| 227 | Ga0495683_0000599 | |||
| 228 | Ga0496126_0045997 | |||
| 229 | Ga0496126_0278997 | |||
| 230 | Ga0496126_0385147 | |||
| 231 | Ga0501033_0033920 | |||
| 232 | Ga0501034_0023258 | |||
| 233 | Ga0501036_0105280 | |||
| 234 | Ga0501046_0301326 | |||
| 235 | Ga0501047_0034848 | |||
| 236 | Ga0501047_0080620 | |||
| 237 | Ga0501069_0025765 | |||
| 238 | Ga0501035_0001705 | |||
| 239 | Ga0501044_0028712 | |||
| 240 | Ga0501044_0117956 | |||
| 241 | nmdc:mga03n38_48872_c1 | |||
| 242 | nmdc:mga00v17_34386_c1 | |||
| 243 | nmdc:mga07m45_90171_c1 | |||
| 244 | nmdc:mga09592_133120_c1 | |||
| 245 | nmdc:mga0sz30_188412_c1 | |||
| 246 | nmdc:mga0sz30_211616_c1 | |||
| 247 | Ga0500635_0065579 | |||
| 248 | Ga0500643_007146 | |||
| 249 | Ga0500641_0199319 | |||
| 250 | Ga0500652_018824 | |||
| 251 | Ga0500658_0023880 | |||
| 252 | Ga0500559_0072528 | |||
| 253 | Ga0500645_000171 | |||
| 254 | Ga0500645_087143 | |||
| 255 | Ga0466962_0000231 | |||
| 256 | 2922556735 | |||
| 257 | 2523382705 | |||
| 258 | 2548696884 | |||
| 259 | 2552109060 | |||
| 260 | 2559424704 | |||
| 261 | 2566995248 | |||
| 262 | 2644512596 | |||
| 263 | 2738705233 | |||
| 264 | 2738892484 | |||
| 265 | 2739205611 | |||
| 266 | 2739237207 | |||
| 267 | 2739334797 | |||
| 268 | 2739361940 | |||
| 269 | 2744954025 | |||
| 270 | 2753035051 | |||
| 271 | 2753323568 | |||
| 272 | 2795782880 | |||
| 273 | 2795796269 | |||
| 274 | 2816510568 | |||
| 275 | 2842891297 | |||
| 276 | 2889301433 | |||
| 277 | 2902801317 | |||
| 278 | 2904539282 | |||
| 279 | 2904769844 | |||
| 280 | 2904771297 | |||
| 281 | 2908816108 | |||
| 282 | 2919423207 | |||
| 283 | 2919435815 | |||
| 284 | 2919717505 | |||
| 285 | 2928144683 | |||
| 286 | 2939749047 | |||
| 287 | 2974317482 | |||
| 288 | 2984525692 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wmv-assembly1.cif.gz_A | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding | 0.9402 | 7 | 209 |
| 6wm5-assembly1.cif.gz_A | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii | 0.9395 | 6 | 209 |
| 6h53-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form | 0.9361 | 18 | 209 |
| 6h5a-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate | 0.9275 | 16 | 210 |
| 6h53-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form | 0.9267 | 18 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPG7_9_203_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9569 | 10 | 203 | 1.20.120.1760 |
| af_P9WPG7_9_203_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9474 | 10 | 203 | 1.20.120.1760 |
| 5d92A02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9083 | 7 | 200 | 1.20.120.1760 |
| 5d92A02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.858 | 7 | 200 | 1.20.120.1760 |
| 4o6mB02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8415 | 7 | 200 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A238WZW0-F1-model_v4 | Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) | 0.9737 | 7 | 202 |
GO:0000287
GO:0005886 GO:0008654 GO:0016780 |
| AF-A0A2S8MN45-F1-model_v4 | deleted | 0.9709 | 44 | 183 |
|
| AF-W5W4K3-F1-model_v4 | Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) | 0.9637 | 3 | 202 |
GO:0000287
GO:0005886 GO:0008654 GO:0016780 |
| AF-A0A6N7H5B7-F1-model_v4 | Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) | 0.9612 | 7 | 202 |
GO:0000287
GO:0005886 GO:0008654 GO:0016780 |
| AF-A0A853BBD9-F1-model_v4 | Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) | 0.9592 | 27 | 202 |
GO:0000287
GO:0005886 GO:0008654 GO:0016780 |