F193239

General Info

Members Datasets Scaffolds Average Seq Length
144 108 288 218

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2922554459|2922556735
Length 248
Sequence IAATSSEPELTTGRVPAVLSFFGRASVSKVTAPMGKALVKTGLTPDSVTVIGTVASVAGAVTLFPSGHLFWGTLFIWFFVMFDMLDGAMARARGGGTRYGAVLDATCDRVADGAIFAGLAWWAVYHENSKWLLVATLICLVTSQVISYAKARAEASGLTADGGWIERPDRLIIVLVGSGLTGMGLPWAIHIAMWVLAAGSVVTVFQRVLAVRNSPGARELLPIAPAASTVEGAAGTEGDPKPEGEAEQ

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
7 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
12 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
30 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
31 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
32 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
33 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
34 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
35 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
36 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
37 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
38 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
41 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
42 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
43 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
44 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
45 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
46 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
47 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
48 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
49 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
50 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
51 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
52 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
53 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
54 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
55 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
61 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
63 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
64 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
65 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
66 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
67 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
68 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
69 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
70 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
71 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
72 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
73 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
74 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
75 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
76 2922554459 Rhodococcus sp. 66b Isolate Unclassified
77 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
78 2547132424 Nocardia nova SH22a Isolate Unclassified
79 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
80 2558860280 Kutzneria sp. 744 Isolate Unclassified
81 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
82 2643221692 Nocardia sp. Root136 Isolate Unclassified
83 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
84 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
85 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
86 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
87 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
88 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
89 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
90 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
91 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
92 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
93 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
94 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
95 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
96 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
97 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
98 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
99 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
100 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
101 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
102 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
103 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
104 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
105 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
106 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
107 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
108 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 77.08
Metatranscriptomes 0
Isolates 22.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 18.06
Nodule 0
Rhizoplane 0
Rhizosphere 63.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1000065 3300003792 Bacteria 126812
2 Ga0055540_1000951 3300003792 Bacteria 18813
3 Ga0070667_100005427 3300005367 Bacteria 10654
4 Ga0070714_100002007 3300005435 Bacteria 14885
5 Ga0070714_100051834 3300005435 Bacteria 3499
6 Ga0070714_100343368 3300005435 Bacteria 1401
7 Ga0070713_100038923 3300005436 Bacteria 3856
8 Ga0070713_100121905 3300005436 Bacteria 2288
9 Ga0068853_100007909 3300005539 Bacteria 8526
10 Ga0068853_100045670 3300005539 Bacteria 3753
11 Ga0068854_100946166 3300005578 Bacteria 760
12 Ga0068852_100013610 3300005616 Bacteria 6228
13 Ga0075365_10091863 3300006038 Bacteria 2069
14 Ga0075363_100128955 3300006048 Bacteria 1417
15 Ga0075363_100291188 3300006048 Bacteria 946
16 Ga0075364_10027071 3300006051 Bacteria 3660
17 Ga0075364_10269636 3300006051 Bacteria 1158
18 Ga0070716_100292486 3300006173 Bacteria 1129
19 Ga0075362_10248228 3300006177 Bacteria 875
20 Ga0075367_10283664 3300006178 Bacteria 1041
21 Ga0075369_10012892 3300006186 Bacteria 3307
22 Ga0075369_10120157 3300006186 Bacteria 1189
23 Ga0075370_10018375 3300006353 Bacteria 3794
24 Ga0105243_10014575 3300009148 Bacteria 5948
25 Ga0105243_10398379 3300009148 Bacteria 1278
26 Ga0105239_10564893 3300010375 Bacteria 1296
27 Ga0157369_10205667 3300013105 Bacteria 2065
28 Ga0213872_10121510 3300021361 Bacteria 1155
29 Ga0213876_10056103 3300021384 Bacteria 2079
30 Ga0209051_1004758 3300025303 Bacteria 8205
31 Ga0207692_10058538 3300025898 Bacteria 1985
32 Ga0207700_10032604 3300025928 Bacteria 3718
33 Ga0207664_10012873 3300025929 Bacteria 5994
34 Ga0207664_10042685 3300025929 Bacteria 3542
35 Ga0207709_10003169 3300025935 Bacteria 9881
36 Ga0207665_10309863 3300025939 Bacteria 1182
37 Ga0207658_10045469 3300025986 Bacteria 3200
38 Ga0207639_10015704 3300026041 Bacteria 5341
39 Ga0265327_10000062 3300031251 Bacteria 234320
40 Ga0265327_10000064 3300031251 Bacteria 231983
41 Ga0265327_10005264 3300031251 Bacteria 10897
42 Ga0307518_10170321 3300031838 Bacteria 1485
43 Ga0307416_100718120 3300032002 Bacteria 1090
44 Ga0373949_0104868 3300035090 Bacteria 778
45 Ga0436364_0425919 3300037853 Bacteria 2311
46 Ga0436365_1666845 3300039437 Bacteria 12280
47 Ga0436361_0383263 3300039447 Bacteria 638
48 Ga0436361_0931192 3300039447 Bacteria 891
49 Ga0466969_0031028 3300044656 Bacteria 2722
50 Ga0466969_0127302 3300044656 Bacteria 1183
51 Ga0466965_0074397 3300044683 Bacteria 1712
52 Ga0466965_0226776 3300044683 Bacteria 997
53 Ga0466966_0004853 3300044684 Bacteria 8848
54 Ga0466966_0089647 3300044684 Bacteria 1910
55 Ga0466966_0111713 3300044684 Bacteria 1684
56 Ga0466961_0011614 3300044693 Bacteria 5629
57 Ga0466961_0064699 3300044693 Bacteria 2324
58 Ga0466963_0005417 3300044694 Bacteria 7471
59 Ga0466963_0279784 3300044694 Bacteria 1173
60 Ga0466964_0067059 3300044706 Bacteria 1508
61 Ga0466971_0007213 3300044719 Bacteria 4841
62 Ga0466971_0285105 3300044719 Bacteria 791
63 Ga0466968_0080655 3300044735 Bacteria 1429
64 Ga0466970_0036303 3300044765 Bacteria 2611
65 Ga0466970_0038610 3300044765 Bacteria 2533
66 Ga0466970_0102380 3300044765 Bacteria 1560
67 Ga0466957_0000944 3300044842 Bacteria 14885
68 Ga0466957_0011746 3300044842 Bacteria 5061
69 Ga0466957_0133415 3300044842 Bacteria 1594
70 Ga0466959_0006765 3300045049 Bacteria 7986
71 Ga0466959_0020538 3300045049 Bacteria 4868
72 Ga0466959_0147504 3300045049 Bacteria 1659
73 Ga0466958_0067266 3300045836 Bacteria 2188
74 Ga0466958_0152428 3300045836 Bacteria 1458
75 Ga0466958_0351379 3300045836 Bacteria 949
76 Ga0466967_0062383 3300045976 Bacteria 3308
77 Ga0466967_0123025 3300045976 Bacteria 2400
78 Ga0466967_0209436 3300045976 Bacteria 1849
79 Ga0495580_0127064 3300046472 Bacteria 1770
80 Ga0495607_0037079 3300046501 Bacteria 2931
81 Ga0495668_0001622 3300046616 Bacteria 21041
82 Ga0495672_0032900 3300047320 Bacteria 3218
83 Ga0495683_0000599 3300047323 Bacteria 27097
84 Ga0496126_0045997 3300048929 Bacteria 4007
85 Ga0496126_0278997 3300048929 Bacteria 1385
86 Ga0496126_0385147 3300048929 Bacteria 1140
87 Ga0501033_0033920 3300049570 Bacteria 3831
88 Ga0501034_0023258 3300049571 Bacteria 6315
89 Ga0501036_0105280 3300049572 Bacteria 2386
90 Ga0501046_0301326 3300049580 Bacteria 1170
91 Ga0501047_0034848 3300049581 Bacteria 4860
92 Ga0501047_0080620 3300049581 Bacteria 3128
93 Ga0501069_0025765 3300049585 Bacteria 3216
94 Ga0501035_0001705 3300049822 Bacteria 22196
95 Ga0501044_0028712 3300049823 Bacteria 5869
96 Ga0501044_0117956 3300049823 Bacteria 2657
97 nmdc:mga03n38_48872_c1 3300050490 Bacteria 1521
98 nmdc:mga00v17_34386_c1 3300050491 Bacteria 3010
99 nmdc:mga07m45_90171_c1 3300050496 Bacteria 1756
100 nmdc:mga09592_133120_c1 3300050508 Bacteria 2140
101 nmdc:mga0sz30_188412_c1 3300050516 Bacteria 916
102 nmdc:mga0sz30_211616_c1 3300050516 Bacteria 861
103 Ga0500635_0065579 3300053080 Bacteria 1277
104 Ga0500643_007146 3300053087 Bacteria 4565
105 Ga0500641_0199319 3300053096 Bacteria 855
106 Ga0500652_018824 3300053131 Bacteria 2556
107 Ga0500658_0023880 3300053134 Bacteria 2339
108 Ga0500559_0072528 3300053136 Bacteria 1552
109 Ga0500645_000171 3300053730 Bacteria 51112
110 Ga0500645_087143 3300053730 Bacteria 887
111 Ga0466962_0000231 3300061719 Bacteria 23213
112 2922556735 2922554459 Bacteria 6683962
113 2523382705 2523231044 Bacteria 6434991
114 2548696884 2547132424 Bacteria 8348532
115 2552109060 2551306166 Bacteria 9731570
116 2559424704 2558860280 Bacteria 11429938
117 2566995248 2565956761 Bacteria 6601618
118 2644512596 2643221692 Bacteria 7282860
119 2738705233 2738541274 Bacteria 6909446
120 2738892484 2738541308 Bacteria 7020677
121 2739205611 2738543005 Bacteria 5278128
122 2739237207 2738543011 Bacteria 5731169
123 2739334797 2738543028 Bacteria 6917070
124 2739361940 2738543034 Bacteria 6084756
125 2744954025 2744054611 Bacteria 5611514
126 2753035051 2751185725 Bacteria 5740550
127 2753323568 2751185792 Bacteria 5739090
128 2795782880 2795385470 Bacteria 8317180
129 2795796269 2795385472 Bacteria 6627535
130 2816510568 2816332139 Bacteria 9138787
131 2842891297 2842888712 Bacteria 4279094
132 2889301433 2889300758 Bacteria 5690814
133 2902801317 2902799365 Bacteria 5419524
134 2904539282 2904535858 Bacteria 6308016
135 2904769844 2904765812 Bacteria 5369154
136 2904771297 2904770941 Bacteria 5580202
137 2908816108 2908811453 Bacteria 5478616
138 2919423207 2919420072 Bacteria 5390363
139 2919435815 2919432681 Bacteria 5390474
140 2919717505 2919713450 Bacteria 7431245
141 2928144683 2928142448 Bacteria 5288925
142 2939749047 2939743619 Bacteria 5762299
143 2974317482 2974315732 Bacteria 4602776
144 2984525692 2984523437 Bacteria 4508481
145 Ga0055540_1000065
146 Ga0055540_1000951
147 Ga0070667_100005427
148 Ga0070714_100002007
149 Ga0070714_100051834
150 Ga0070714_100343368
151 Ga0070713_100038923
152 Ga0070713_100121905
153 Ga0068853_100007909
154 Ga0068853_100045670
155 Ga0068854_100946166
156 Ga0068852_100013610
157 Ga0075365_10091863
158 Ga0075363_100128955
159 Ga0075363_100291188
160 Ga0075364_10027071
161 Ga0075364_10269636
162 Ga0070716_100292486
163 Ga0075362_10248228
164 Ga0075367_10283664
165 Ga0075369_10012892
166 Ga0075369_10120157
167 Ga0075370_10018375
168 Ga0105243_10014575
169 Ga0105243_10398379
170 Ga0105239_10564893
171 Ga0157369_10205667
172 Ga0213872_10121510
173 Ga0213876_10056103
174 Ga0209051_1004758
175 Ga0207692_10058538
176 Ga0207700_10032604
177 Ga0207664_10012873
178 Ga0207664_10042685
179 Ga0207709_10003169
180 Ga0207665_10309863
181 Ga0207658_10045469
182 Ga0207639_10015704
183 Ga0265327_10000062
184 Ga0265327_10000064
185 Ga0265327_10005264
186 Ga0307518_10170321
187 Ga0307416_100718120
188 Ga0373949_0104868
189 Ga0436364_0425919
190 Ga0436365_1666845
191 Ga0436361_0383263
192 Ga0436361_0931192
193 Ga0466969_0031028
194 Ga0466969_0127302
195 Ga0466965_0074397
196 Ga0466965_0226776
197 Ga0466966_0004853
198 Ga0466966_0089647
199 Ga0466966_0111713
200 Ga0466961_0011614
201 Ga0466961_0064699
202 Ga0466963_0005417
203 Ga0466963_0279784
204 Ga0466964_0067059
205 Ga0466971_0007213
206 Ga0466971_0285105
207 Ga0466968_0080655
208 Ga0466970_0036303
209 Ga0466970_0038610
210 Ga0466970_0102380
211 Ga0466957_0000944
212 Ga0466957_0011746
213 Ga0466957_0133415
214 Ga0466959_0006765
215 Ga0466959_0020538
216 Ga0466959_0147504
217 Ga0466958_0067266
218 Ga0466958_0152428
219 Ga0466958_0351379
220 Ga0466967_0062383
221 Ga0466967_0123025
222 Ga0466967_0209436
223 Ga0495580_0127064
224 Ga0495607_0037079
225 Ga0495668_0001622
226 Ga0495672_0032900
227 Ga0495683_0000599
228 Ga0496126_0045997
229 Ga0496126_0278997
230 Ga0496126_0385147
231 Ga0501033_0033920
232 Ga0501034_0023258
233 Ga0501036_0105280
234 Ga0501046_0301326
235 Ga0501047_0034848
236 Ga0501047_0080620
237 Ga0501069_0025765
238 Ga0501035_0001705
239 Ga0501044_0028712
240 Ga0501044_0117956
241 nmdc:mga03n38_48872_c1
242 nmdc:mga00v17_34386_c1
243 nmdc:mga07m45_90171_c1
244 nmdc:mga09592_133120_c1
245 nmdc:mga0sz30_188412_c1
246 nmdc:mga0sz30_211616_c1
247 Ga0500635_0065579
248 Ga0500643_007146
249 Ga0500641_0199319
250 Ga0500652_018824
251 Ga0500658_0023880
252 Ga0500559_0072528
253 Ga0500645_000171
254 Ga0500645_087143
255 Ga0466962_0000231
256 2922556735
257 2523382705
258 2548696884
259 2552109060
260 2559424704
261 2566995248
262 2644512596
263 2738705233
264 2738892484
265 2739205611
266 2739237207
267 2739334797
268 2739361940
269 2744954025
270 2753035051
271 2753323568
272 2795782880
273 2795796269
274 2816510568
275 2842891297
276 2889301433
277 2902801317
278 2904539282
279 2904769844
280 2904771297
281 2908816108
282 2919423207
283 2919435815
284 2919717505
285 2928144683
286 2939749047
287 2974317482
288 2984525692

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

42

206

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.9402 7 209
6wm5-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.9395 6 209
6h53-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form 0.9361 18 209
6h5a-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate 0.9275 16 210
6h53-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form 0.9267 18 209
ID Description Score Start End Superfamily
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9569 10 203 1.20.120.1760
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9474 10 203 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9083 7 200 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.858 7 200 1.20.120.1760
4o6mB02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8415 7 200 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A238WZW0-F1-model_v4 Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) 0.9737 7 202 GO:0000287
GO:0005886
GO:0008654
GO:0016780
AF-A0A2S8MN45-F1-model_v4 deleted 0.9709 44 183
AF-W5W4K3-F1-model_v4 Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) 0.9637 3 202 GO:0000287
GO:0005886
GO:0008654
GO:0016780
AF-A0A6N7H5B7-F1-model_v4 Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) 0.9612 7 202 GO:0000287
GO:0005886
GO:0008654
GO:0016780
AF-A0A853BBD9-F1-model_v4 Phosphatidylinositol phosphate synthase (PIP synthase) (EC 2.7.8.-) (CDP-diacylglycerol--D-myo-inositol-3-phosphate 3-phosphatidyltransferase) 0.9592 27 202 GO:0000287
GO:0005886
GO:0008654
GO:0016780

Map