F192909

General Info

Members Datasets Scaffolds Average Seq Length
144 92 144 323

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0327777|Ga0501034_0327777_248_1405
Length 368
Sequence MKSMSKRDYYEVLEVHKTATIEEIKKSYRKLAVKFHPDKNPSDKTAEEKFKEISEAYEALSDAQKRAAYDQYGHAAFDPRSRGFRPGFHDPFEIFREVFGANTGGSIFDDLFGGGGRSDPSGPHRGADLRYDMEISFEEAVMGTEKEVSLTKLEQCEHCHGTGGEAGSSRKVCPTCGGRGQVVMARGIFSIAQERPCKVXXXAGRREKNTKIKLKIPAGVDSGARLRSTGNGEAGLRGGAHGDLYVVLHVKPHDIFQRDGDDLLCDVPVQFVQAALGAEIEVPTLTGKAHIRIPPGTQTHTVFRLKGKGVKSLQGSGHGDLHVRVAVEIPRNMNSAQKAKLQEFADLCDATVNPITRGFFDKAKEFFR

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
32 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
33 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
34 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
35 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
36 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
39 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
40 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
41 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
42 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
43 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
57 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
60 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
61 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
62 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
63 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
64 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
65 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
66 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
67 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
68 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
86 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 6.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100007018 3300005330 Bacteria 6422
2 Ga0068869_100032787 3300005334 Bacteria 3663
3 Ga0068868_100150554 3300005338 Bacteria 1916
4 Ga0070689_100034173 3300005340 Bacteria 3879
5 Ga0070687_100027975 3300005343 Bacteria 2729
6 Ga0070661_100002355 3300005344 Bacteria 12971
7 Ga0070694_100087670 3300005444 Bacteria 2178
8 Ga0068867_100000149 3300005459 Bacteria 44625
9 Ga0070698_100055963 3300005471 Bacteria 3998
10 Ga0070699_100000001 3300005518 Bacteria 910751
11 Ga0070686_100007850 3300005544 Bacteria 5966
12 Ga0070695_100159242 3300005545 Bacteria 1583
13 Ga0070664_100000198 3300005564 Bacteria 42691
14 Ga0068857_100056734 3300005577 Bacteria 3476
15 Ga0068852_100314462 3300005616 Bacteria 1519
16 Ga0068864_100160315 3300005618 Bacteria 2044
17 Ga0068864_100177042 3300005618 Bacteria 1948
18 Ga0068863_100023707 3300005841 Bacteria 5857
19 Ga0075433_10016150 3300006852 Bacteria 6142
20 Ga0075433_10220372 3300006852 Bacteria 1685
21 Ga0075434_100069784 3300006871 Bacteria 3503
22 Ga0111539_10129358 3300009094 Unclassified 2957
23 Ga0105243_10000062 3300009148 Bacteria 127525
24 Ga0105242_10107417 3300009176 Bacteria 2374
25 Ga0163163_10098279 3300014325 Bacteria 2948
26 Ga0207649_10001646 3300025920 Bacteria 12964
27 Ga0207709_10000512 3300025935 Bacteria 34044
28 Ga0207679_10000450 3300025945 Bacteria 29057
29 Ga0207641_10054772 3300026088 Bacteria 3386
30 Ga0207648_10000474 3300026089 Bacteria 44892
31 Ga0207676_10121943 3300026095 Bacteria 2200
32 Ga0207674_10044010 3300026116 Bacteria 4601
33 Ga0265337_1000117 3300028556 Bacteria 40735
34 Ga0265326_10002665 3300028558 Bacteria 5979
35 Ga0265326_10018147 3300028558 Bacteria 2026
36 Ga0265319_1004892 3300028563 Bacteria 6548
37 Ga0265319_1005724 3300028563 Bacteria 5889
38 Ga0265334_10006776 3300028573 Bacteria 4920
39 Ga0265318_10000802 3300028577 Bacteria 20838
40 Ga0265318_10002880 3300028577 Bacteria 8960
41 Ga0265318_10009963 3300028577 Bacteria 4158
42 Ga0265336_10002848 3300028666 Bacteria 6972
43 Ga0265338_10000008 3300028800 Bacteria 481542
44 Ga0265338_10000309 3300028800 Bacteria 88345
45 Ga0265338_10000487 3300028800 Bacteria 70806
46 Ga0265338_10001032 3300028800 Bacteria 46571
47 Ga0265338_10003037 3300028800 Bacteria 24157
48 Ga0265338_10006433 3300028800 Bacteria 14972
49 Ga0265338_10011444 3300028800 Bacteria 10245
50 Ga0265338_10015698 3300028800 Bacteria 8300
51 Ga0265338_10059862 3300028800 Bacteria 3352
52 Ga0265324_10001028 3300029957 Bacteria 17139
53 Ga0265324_10021509 3300029957 Bacteria 2312
54 Ga0265324_10031023 3300029957 Unclassified 1874
55 Ga0265330_10020425 3300031235 Bacteria 3026
56 Ga0265330_10073260 3300031235 Bacteria 1481
57 Ga0265328_10003063 3300031239 Bacteria 7463
58 Ga0265320_10001118 3300031240 Bacteria 19763
59 Ga0265320_10015615 3300031240 Bacteria 4287
60 Ga0265320_10018802 3300031240 Bacteria 3795
61 Ga0265320_10046202 3300031240 Bacteria 2135
62 Ga0265339_10024889 3300031249 Bacteria 3444
63 Ga0265339_10084387 3300031249 Bacteria 1674
64 Ga0265331_10012244 3300031250 Bacteria 4654
65 Ga0265327_10006040 3300031251 Bacteria 9826
66 Ga0265327_10014146 3300031251 Bacteria 5238
67 Ga0265316_10001616 3300031344 Bacteria 24035
68 Ga0265316_10013276 3300031344 Bacteria 7328
69 Ga0265316_10017975 3300031344 Bacteria 6093
70 Ga0265316_10045854 3300031344 Bacteria 3468
71 Ga0265316_10096163 3300031344 Bacteria 2255
72 Ga0307408_100000035 3300031548 Bacteria 205352
73 Ga0265313_10001630 3300031595 Bacteria 20838
74 Ga0265313_10010826 3300031595 Bacteria 5728
75 Ga0265314_10000034 3300031711 Bacteria 241556
76 Ga0265314_10010662 3300031711 Bacteria 7648
77 Ga0265314_10100515 3300031711 Bacteria 1860
78 Ga0265342_10021407 3300031712 Bacteria 4130
79 Ga0307410_10050559 3300031852 Bacteria 2796
80 Ga0307407_10000055 3300031903 Bacteria 49621
81 Ga0307412_10000025 3300031911 Bacteria 235413
82 Ga0307416_100008948 3300032002 Bacteria 6510
83 Ga0307414_10058063 3300032004 Bacteria 2724
84 Ga0316593_10002659 3300032168 Bacteria 4289
85 Ga0373928_0002709 3300035084 Bacteria 3426
86 Ga0373932_0003695 3300035112 Bacteria 3656
87 Ga0373937_0232732 3300036401 Bacteria 1735
88 Ga0400490_42559 3300038726 Bacteria 3523
89 Ga0400490_50693 3300038726 Bacteria 47921
90 Ga0400490_50872 3300038726 Bacteria 33578
91 Ga0400490_57040 3300038726 Bacteria 2854
92 Ga0400485_10235 3300038735 Bacteria 2422
93 Ga0400483_021645 3300039062 Bacteria 4049
94 Ga0400483_259545 3300039062 Bacteria 2666
95 Ga0400487_12529 3300039110 Bacteria 19079
96 Ga0400487_34970 3300039110 Bacteria 222491
97 Ga0439453_0003553 3300041408 Bacteria 2250
98 Ga0450890_000031 3300042127 Bacteria 33632
99 Ga0450891_002511 3300042129 Bacteria 1844
100 Ga0450892_000131 3300042130 Bacteria 8602
101 Ga0450889_003374 3300042144 Bacteria 1575
102 Ga0450893_0000033 3300042532 Bacteria 13093
103 Ga0450893_0000380 3300042532 Bacteria 6206
104 Ga0451577_0000025 3300042876 Bacteria 403632
105 Ga0451577_0001800 3300042876 Bacteria 27427
106 Ga0451577_0029467 3300042876 Bacteria 4962
107 Ga0451577_0085322 3300042876 Bacteria 2817
108 Ga0451577_0094232 3300042876 Bacteria 2673
109 Ga0453683_0001737 3300044673 Bacteria 18079
110 Ga0453683_0052702 3300044673 Bacteria 2547
111 Ga0453684_0000242 3300044712 Bacteria 234895
112 Ga0453684_0001655 3300044712 Bacteria 60458
113 Ga0453684_0005960 3300044712 Bacteria 23630
114 Ga0453684_0009113 3300044712 Bacteria 17483
115 Ga0453684_0102456 3300044712 Bacteria 3500
116 Ga0453684_0158281 3300044712 Bacteria 2682
117 Ga0451576_0004441 3300045051 Bacteria 18215
118 Ga0451576_0028983 3300045051 Bacteria 5928
119 Ga0451576_0052333 3300045051 Bacteria 4279
120 Ga0451576_0234429 3300045051 Bacteria 1917
121 Ga0495592_0000012 3300046454 Bacteria 154054
122 Ga0495618_0001517 3300046514 Bacteria 15587
123 Ga0495618_0002124 3300046514 Bacteria 12985
124 Ga0495628_0000320 3300046516 Bacteria 43366
125 Ga0495586_0000867 3300046535 Bacteria 17339
126 Ga0495645_0008449 3300046543 Bacteria 7192
127 Ga0495645_0166626 3300046543 Bacteria 1519
128 Ga0495667_0040208 3300046559 Bacteria 3106
129 Ga0495634_0055205 3300046642 Bacteria 2656
130 Ga0495634_0081182 3300046642 Bacteria 2121
131 Ga0495646_0130072 3300046680 Bacteria 1418
132 Ga0495613_0002183 3300046689 Bacteria 14816
133 Ga0495624_0171469 3300046690 Bacteria 1323
134 Ga0495674_0031407 3300047319 Bacteria 4825
135 Ga0495680_0002831 3300047322 Bacteria 17453
136 Ga0496121_0037752 3300048924 Bacteria 4286
137 Ga0501032_0009808 3300049569 Bacteria 6927
138 Ga0501034_0327777 3300049571 Bacteria 1463
139 Ga0501038_0072752 3300049574 Bacteria 2913
140 Ga0501047_0026735 3300049581 Bacteria 5554
141 Ga0501035_0047281 3300049822 Bacteria 3863
142 Ga0501044_0267636 3300049823 Bacteria 1646
143 nmdc:mga0a205_2528_c1 3300050515 Bacteria 16113
144 nmdc:mga0a205_290954_c1 3300050515 Bacteria 1508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100032787 Ga0068869_1000327873 261
2 3300005459 Ga0068867_100000149 Ga0068867_10000014915 261
3 3300009148 Ga0105243_10000062 Ga0105243_1000006226 261
4 3300025935 Ga0207709_10000512 Ga0207709_100005122 261
5 3300026089 Ga0207648_10000474 Ga0207648_1000047426 261
6 3300045051 Ga0451576_0234429 Ga0451576_0234429_354_1529 261
7 3300031852 Ga0307410_10050559 Ga0307410_100505593 268
8 3300031903 Ga0307407_10000055 Ga0307407_100000559 268
9 3300032002 Ga0307416_100008948 Ga0307416_1000089482 268
10 3300048924 Ga0496121_0037752 Ga0496121_0037752_685_1842 268
11 3300028800 Ga0265338_10000008 Ga0265338_10000008363 270
12 3300029957 Ga0265324_10021509 Ga0265324_100215093 270
13 3300031249 Ga0265339_10024889 Ga0265339_100248892 270
14 3300031344 Ga0265316_10045854 Ga0265316_100458542 270
15 3300031911 Ga0307412_10000025 Ga0307412_10000025120 271
16 3300041408 Ga0439453_0003553 Ga0439453_0003553_1061_2212 271
17 3300042127 Ga0450890_000031 Ga0450890_000031_10858_12009 271
18 3300042129 Ga0450891_002511 Ga0450891_002511_47_1198 271
19 3300042130 Ga0450892_000131 Ga0450892_000131_4643_5794 271
20 3300042532 Ga0450893_0000033 Ga0450893_0000033_318_1466 271
21 3300042532 Ga0450893_0000380 Ga0450893_0000380_2188_3339 271
22 3300031235 Ga0265330_10020425 Ga0265330_100204252 272
23 3300031344 Ga0265316_10013276 Ga0265316_100132765 272
24 3300031548 Ga0307408_100000035 Ga0307408_10000003535 272
25 3300009094 Ga0111539_10129358 Ga0111539_101293583 273
26 3300042144 Ga0450889_003374 Ga0450889_003374_106_1257 273
27 3300032004 Ga0307414_10058063 Ga0307414_100580632 274
28 3300044712 Ga0453684_0009113 Ga0453684_0009113_15173_16294 274
29 3300031712 Ga0265342_10021407 Ga0265342_100214072 275
30 3300044712 Ga0453684_0102456 Ga0453684_0102456_1087_2247 276
31 3300028563 Ga0265319_1005724 Ga0265319_10057245 277
32 3300028577 Ga0265318_10002880 Ga0265318_100028807 277
33 3300031249 Ga0265339_10084387 Ga0265339_100843872 277
34 3300031595 Ga0265313_10001630 Ga0265313_100016307 277
35 3300031711 Ga0265314_10100515 Ga0265314_101005152 277
36 3300038735 Ga0400485_10235 Ga0400485_10235_427_1566 277
37 3300042876 Ga0451577_0001800 Ga0451577_0001800_19931_21082 277
38 3300044673 Ga0453683_0001737 Ga0453683_0001737_5267_6397 277
39 3300044712 Ga0453684_0158281 Ga0453684_0158281_1134_2234 277
40 3300005344 Ga0070661_100002355 Ga0070661_1000023553 280
41 3300005564 Ga0070664_100000198 Ga0070664_10000019822 280
42 3300005616 Ga0068852_100314462 Ga0068852_1003144622 280
43 3300025920 Ga0207649_10001646 Ga0207649_1000164613 280
44 3300025945 Ga0207679_10000450 Ga0207679_100004503 280
45 3300049569 Ga0501032_0009808 Ga0501032_0009808_2907_4058 280
46 3300049574 Ga0501038_0072752 Ga0501038_0072752_1106_2215 280
47 3300039110 Ga0400487_12529 Ga0400487_12529_7545_8702 281
48 3300038726 Ga0400490_50693 Ga0400490_50693_2958_4094 282
49 3300038726 Ga0400490_50872 Ga0400490_50872_11330_12466 282
50 3300039110 Ga0400487_34970 Ga0400487_34970_210078_211214 282
51 3300028800 Ga0265338_10000487 Ga0265338_1000048729 283
52 3300031344 Ga0265316_10001616 Ga0265316_1000161617 283
53 3300039062 Ga0400483_021645 Ga0400483_021645_669_1805 283
54 3300039062 Ga0400483_259545 Ga0400483_259545_1510_2646 283
55 3300044712 Ga0453684_0005960 Ga0453684_0005960_7173_8291 284
56 3300031250 Ga0265331_10012244 Ga0265331_100122442 285
57 3300031251 Ga0265327_10006040 Ga0265327_100060407 285
58 3300042876 Ga0451577_0085322 Ga0451577_0085322_397_1557 285
59 3300044712 Ga0453684_0001655 Ga0453684_0001655_7796_8956 285
60 3300006852 Ga0075433_10220372 Ga0075433_102203722 286
61 3300038726 Ga0400490_57040 Ga0400490_57040_53_1201 286
62 3300044712 Ga0453684_0000242 Ga0453684_0000242_53009_54142 286
63 3300050515 nmdc:mga0a205_290954_c1 nmdc:mga0a205_290954_c1_21_1163 286
64 3300009176 Ga0105242_10107417 Ga0105242_101074171 287
65 3300028800 Ga0265338_10000309 Ga0265338_1000030929 287
66 3300029957 Ga0265324_10001028 Ga0265324_100010282 287
67 3300035084 Ga0373928_0002709 Ga0373928_0002709_1104_2219 287
68 3300035112 Ga0373932_0003695 Ga0373932_0003695_833_1948 287
69 3300038726 Ga0400490_42559 Ga0400490_42559_598_1746 287
70 3300032168 Ga0316593_10002659 Ga0316593_100026592 288
71 3300049581 Ga0501047_0026735 Ga0501047_0026735_1725_2882 289
72 3300049822 Ga0501035_0047281 Ga0501035_0047281_198_1355 289
73 3300006871 Ga0075434_100069784 Ga0075434_1000697842 294
74 3300006852 Ga0075433_10016150 Ga0075433_100161504 295
75 3300028563 Ga0265319_1004892 Ga0265319_10048922 295
76 3300028577 Ga0265318_10000802 Ga0265318_100008022 295
77 3300042876 Ga0451577_0000025 Ga0451577_0000025_334042_335205 295
78 3300050515 nmdc:mga0a205_2528_c1 nmdc:mga0a205_2528_c1_3999_5120 295
79 3300031235 Ga0265330_10073260 Ga0265330_100732602 297
80 3300042876 Ga0451577_0094232 Ga0451577_0094232_29_1162 297
81 3300005545 Ga0070695_100159242 Ga0070695_1001592422 299
82 3300029957 Ga0265324_10031023 Ga0265324_100310232 299
83 3300028800 Ga0265338_10015698 Ga0265338_100156986 300
84 3300031240 Ga0265320_10018802 Ga0265320_100188023 300
85 3300028558 Ga0265326_10018147 Ga0265326_100181472 301
86 3300028573 Ga0265334_10006776 Ga0265334_100067764 301
87 3300028800 Ga0265338_10006433 Ga0265338_100064338 301
88 3300031239 Ga0265328_10003063 Ga0265328_100030635 301
89 3300031344 Ga0265316_10017975 Ga0265316_100179755 301
90 3300031344 Ga0265316_10096163 Ga0265316_100961632 301
91 3300031595 Ga0265313_10010826 Ga0265313_100108262 301
92 3300031711 Ga0265314_10000034 Ga0265314_10000034137 301
93 3300031711 Ga0265314_10010662 Ga0265314_100106623 301
94 3300046454 Ga0495592_0000012 Ga0495592_0000012_130109_131227 301
95 3300046514 Ga0495618_0002124 Ga0495618_0002124_839_1957 301
96 3300046516 Ga0495628_0000320 Ga0495628_0000320_34569_35687 301
97 3300046535 Ga0495586_0000867 Ga0495586_0000867_10062_11180 301
98 3300046543 Ga0495645_0008449 Ga0495645_0008449_5231_6349 301
99 3300046690 Ga0495624_0171469 Ga0495624_0171469_114_1232 301
100 3300047319 Ga0495674_0031407 Ga0495674_0031407_3023_4141 301
101 3300028577 Ga0265318_10009963 Ga0265318_100099632 302
102 3300042876 Ga0451577_0029467 Ga0451577_0029467_501_1652 302
103 3300045051 Ga0451576_0004441 Ga0451576_0004441_2163_3323 302
104 3300028556 Ga0265337_1000117 Ga0265337_100011714 303
105 3300028558 Ga0265326_10002665 Ga0265326_100026653 303
106 3300028666 Ga0265336_10002848 Ga0265336_100028483 303
107 3300028800 Ga0265338_10001032 Ga0265338_1000103227 303
108 3300031240 Ga0265320_10015615 Ga0265320_100156154 303
109 3300005544 Ga0070686_100007850 Ga0070686_1000078505 304
110 3300028800 Ga0265338_10059862 Ga0265338_100598623 305
111 3300046680 Ga0495646_0130072 Ga0495646_0130072_76_1215 305
112 3300005343 Ga0070687_100027975 Ga0070687_1000279753 306
113 3300031240 Ga0265320_10046202 Ga0265320_100462023 306
114 3300005577 Ga0068857_100056734 Ga0068857_1000567344 307
115 3300005618 Ga0068864_100160315 Ga0068864_1001603152 307
116 3300005618 Ga0068864_100177042 Ga0068864_1001770422 307
117 3300005841 Ga0068863_100023707 Ga0068863_1000237074 307
118 3300014325 Ga0163163_10098279 Ga0163163_100982791 307
119 3300026088 Ga0207641_10054772 Ga0207641_100547723 307
120 3300026095 Ga0207676_10121943 Ga0207676_101219432 307
121 3300026116 Ga0207674_10044010 Ga0207674_100440105 307
122 3300045051 Ga0451576_0052333 Ga0451576_0052333_1255_2397 307
123 3300046559 Ga0495667_0040208 Ga0495667_0040208_149_1288 307
124 3300028800 Ga0265338_10011444 Ga0265338_100114446 308
125 3300031240 Ga0265320_10001118 Ga0265320_100011184 308
126 3300031251 Ga0265327_10014146 Ga0265327_100141463 308
127 3300005338 Ga0068868_100150554 Ga0068868_1001505542 309
128 3300028800 Ga0265338_10003037 Ga0265338_1000303711 309
129 3300036401 Ga0373937_0232732 Ga0373937_0232732_10_1143 309
130 3300046514 Ga0495618_0001517 Ga0495618_0001517_13406_14539 309
131 3300046642 Ga0495634_0055205 Ga0495634_0055205_1499_2632 309
132 3300046642 Ga0495634_0081182 Ga0495634_0081182_964_2097 309
133 3300046689 Ga0495613_0002183 Ga0495613_0002183_952_2085 309
134 3300047322 Ga0495680_0002831 Ga0495680_0002831_11698_12831 309
135 3300005340 Ga0070689_100034173 Ga0070689_1000341732 310
136 3300046543 Ga0495645_0166626 Ga0495645_0166626_214_1338 310
137 3300045051 Ga0451576_0028983 Ga0451576_0028983_4357_5487 311
138 3300049571 Ga0501034_0327777 Ga0501034_0327777_248_1405 311
139 3300005330 Ga0070690_100007018 Ga0070690_1000070187 312
140 3300005444 Ga0070694_100087670 Ga0070694_1000876702 312
141 3300005471 Ga0070698_100055963 Ga0070698_1000559633 312
142 3300005518 Ga0070699_100000001 Ga0070699_100000001409 312
143 3300044673 Ga0453683_0052702 Ga0453683_0052702_750_1871 312
144 3300049823 Ga0501044_0267636 Ga0501044_0267636_35_1192 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

8

70

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

129

330

0.98

Feature Viewer

pLDDT pTM Quality
72.6 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map