F192138

General Info

Members Datasets Scaffolds Average Seq Length
144 120 288 204

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10000126|Ga0265316_1000012654
Length 228
Sequence MRKPCQPKTMLPTLEFVAPDYPEHPMTDLKKPSKTGALPSFIFASRWLQLPLYLGLILAQAVYVFHFWVELVHLVEAAFGNPDALRAIFEASGQHSDHPPSHLTETTIMLVVLGLIDVVMISNLLIMVIVGGYETFVSRMGLEGHPDQPEWLDQVNASVLKVKLGTAIIGISSIHLLKTFINAENYSEKALIAQTVIHIAFLLSAMAIAFTDRLIHPPHGPSDHGKPH

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
32 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
63 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
64 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
70 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
71 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
72 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
73 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
74 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
75 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
76 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
86 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
87 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
95 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
96 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
97 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
102 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
103 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
104 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
105 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
106 2547132374 Acidovorax radicis N35 Isolate Unclassified
107 2643221570 Acidovorax sp. Root568 Isolate Unclassified
108 2643221596 Acidovorax sp. Root70 Isolate Unclassified
109 2643221609 Acidovorax sp. Root217 Isolate Unclassified
110 2643221611 Acidovorax sp. Root219 Isolate Unclassified
111 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
112 2643221652 Acidovorax sp. Root402 Isolate Unclassified
113 2643221660 Methylibium sp. Root1272 Isolate Unclassified
114 2643221717 Acidovorax sp. Root267 Isolate Unclassified
115 2738541337 Pelomonas sp. BT06 Isolate Unclassified
116 2738543012 Acidovorax sp. CF301 Isolate Unclassified
117 2816332133 Acidovorax radicis 2721A Isolate Unclassified
118 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
119 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
120 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.58
Metatranscriptomes 0
Isolates 10.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.89
Nodule 0.69
Rhizoplane 3.47
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10000126 3300031344 Bacteria 83546
2 Ga0055524_1000703 3300003775 Bacteria 23198
3 Ga0055531_10006311 3300003794 Bacteria 6750
4 Ga0055531_10055251 3300003794 Bacteria 1011
5 Ga0055543_1016934 3300004625 Bacteria 1378
6 Ga0065165_1000613 3300005262 Bacteria 51836
7 Ga0070676_10015506 3300005328 Bacteria 4204
8 Ga0070670_100034171 3300005331 Bacteria 4376
9 Ga0070677_10012211 3300005333 Bacteria 2979
10 Ga0068869_100013338 3300005334 Bacteria 5463
11 Ga0070666_10222175 3300005335 Bacteria 1332
12 Ga0070675_100117096 3300005354 Bacteria 2261
13 Ga0070673_100013397 3300005364 Bacteria 5671
14 Ga0070673_100914464 3300005364 Bacteria 814
15 Ga0070667_100038959 3300005367 Bacteria 3985
16 Ga0070667_100962894 3300005367 Bacteria 796
17 Ga0070678_100520977 3300005456 Bacteria 1052
18 Ga0068867_100003273 3300005459 Bacteria 11412
19 Ga0068867_100218764 3300005459 Bacteria 1534
20 Ga0070672_100008225 3300005543 Bacteria 7128
21 Ga0070672_100030343 3300005543 Bacteria 4061
22 Ga0070665_100772738 3300005548 Bacteria 974
23 Ga0070665_100786489 3300005548 Bacteria 965
24 Ga0068857_100418844 3300005577 Bacteria 1248
25 Ga0068859_100260340 3300005617 Bacteria 1826
26 Ga0068864_100193078 3300005618 Bacteria 1867
27 Ga0068864_100458655 3300005618 Bacteria 1220
28 Ga0075366_10042674 3300006195 Bacteria 2686
29 Ga0075366_10258515 3300006195 Bacteria 1063
30 Ga0075370_10116038 3300006353 Bacteria 1557
31 Ga0075370_10489428 3300006353 Bacteria 742
32 Ga0075429_100001289 3300006880 Bacteria 20430
33 Ga0097620_100260339 3300006931 Bacteria 1826
34 Ga0105240_10113763 3300009093 Bacteria 3270
35 Ga0105241_10413426 3300009174 Bacteria 1186
36 Ga0105248_10014513 3300009177 Bacteria 8672
37 Ga0105237_10006384 3300009545 Bacteria 13084
38 Ga0105238_10079356 3300009551 Bacteria 3272
39 Ga0105239_10096538 3300010375 Bacteria 3265
40 Ga0157317_1004150 3300012475 Bacteria 933
41 Ga0157319_1000010 3300012497 Bacteria 197331
42 Ga0157379_10920302 3300014968 Bacteria 830
43 Ga0213872_10019131 3300021361 Bacteria 3154
44 Ga0209256_1001656 3300025299 Bacteria 21662
45 Ga0209257_1000578 3300025304 Bacteria 61654
46 Ga0209257_1012987 3300025304 Bacteria 3763
47 Ga0207645_10006011 3300025907 Bacteria 8731
48 Ga0207695_10083326 3300025913 Bacteria 3230
49 Ga0207671_10078357 3300025914 Bacteria 2475
50 Ga0207694_10052122 3300025924 Bacteria 3172
51 Ga0207650_10160598 3300025925 Bacteria 1780
52 Ga0207659_10428637 3300025926 Bacteria 1110
53 Ga0207690_10301671 3300025932 Bacteria 1254
54 Ga0207709_10377808 3300025935 Bacteria 1077
55 Ga0207691_10050580 3300025940 Bacteria 3804
56 Ga0207691_10096629 3300025940 Bacteria 2641
57 Ga0207689_10016772 3300025942 Bacteria 6200
58 Ga0207658_10031291 3300025986 Bacteria 3777
59 Ga0207658_10511263 3300025986 Bacteria 1071
60 Ga0207658_10761981 3300025986 Bacteria 877
61 Ga0207648_10005753 3300026089 Bacteria 12424
62 Ga0207648_10254546 3300026089 Bacteria 1566
63 Ga0207674_10145356 3300026116 Bacteria 2330
64 Ga0209974_10018319 3300027876 Bacteria 2323
65 Ga0307515_10000026 3300028794 Bacteria 382411
66 Ga0307515_10153593 3300028794 Bacteria 2391
67 Ga0265328_10142503 3300031239 Bacteria 899
68 Ga0265327_10000341 3300031251 Bacteria 88581
69 Ga0307513_10040754 3300031456 Bacteria 5132
70 Ga0307513_10119936 3300031456 Bacteria 2600
71 Ga0307509_10000041 3300031507 Bacteria 182302
72 Ga0307408_100003007 3300031548 Bacteria 11658
73 Ga0307408_100039583 3300031548 Bacteria 3333
74 Ga0307508_10339903 3300031616 Bacteria 1093
75 Ga0307516_10029729 3300031730 Bacteria 5521
76 Ga0307413_10635480 3300031824 Bacteria 878
77 Ga0307406_10002339 3300031901 Bacteria 10300
78 Ga0307510_10118306 3300033180 Bacteria 2363
79 Ga0373940_0011490 3300035088 Bacteria 2103
80 Ga0373939_0000139 3300035114 Bacteria 20747
81 Ga0373962_0065183 3300035242 Bacteria 1078
82 Ga0373931_0000908 3300035691 Bacteria 12513
83 Ga0373937_0245758 3300036401 Bacteria 1686
84 Ga0395905_0006177 3300037471 Bacteria 12094
85 Ga0395905_0056396 3300037471 Bacteria 3675
86 Ga0436361_0513759 3300039447 Bacteria 41887
87 Ga0439447_060147 3300041407 Bacteria 895
88 Ga0451791_0601287 3300041451 Bacteria 1718
89 Ga0451807_0982942 3300041486 Bacteria 803
90 Ga0450917_001520 3300042120 Bacteria 1662
91 Ga0450890_000536 3300042127 Bacteria 5601
92 Ga0450890_003410 3300042127 Bacteria 2112
93 Ga0450891_000192 3300042129 Bacteria 5988
94 Ga0439458_0043130 3300042157 Bacteria 1099
95 Ga0439459_0000871 3300042438 Bacteria 4217
96 Ga0451577_0085140 3300042876 Bacteria 2820
97 Ga0466972_0095663 3300044658 Bacteria 1407
98 Ga0453684_0209605 3300044712 Bacteria 2266
99 Ga0453684_1542043 3300044712 Bacteria 684
100 Ga0466968_0012168 3300044735 Bacteria 3361
101 Ga0451576_0042247 3300045051 Bacteria 4814
102 Ga0451576_0134032 3300045051 Bacteria 2583
103 Ga0451576_0177186 3300045051 Bacteria 2226
104 Ga0451576_0469186 3300045051 Bacteria 1322
105 Ga0495592_0001070 3300046454 Bacteria 18948
106 Ga0495607_0053869 3300046501 Bacteria 2321
107 Ga0495606_0044439 3300046507 Bacteria 2954
108 Ga0495648_0109741 3300046524 Bacteria 1504
109 Ga0495686_0108167 3300047472 Bacteria 1670
110 Ga0495614_0072171 3300048089 Bacteria 1489
111 Ga0496104_0076702 3300048907 Bacteria 3184
112 Ga0496109_0526353 3300048912 Bacteria 1116
113 Ga0496112_0017304 3300048915 Bacteria 6770
114 Ga0496121_0052063 3300048924 Bacteria 3442
115 Ga0496124_0000487 3300048927 Bacteria 68031
116 Ga0501042_0227222 3300049578 Bacteria 1346
117 Ga0501075_0076627 3300049591 Bacteria 2530
118 Ga0501222_045865 3300049662 Bacteria 631
119 Ga0501262_002357 3300049759 Bacteria 2137
120 Ga0501266_001164 3300049763 Bacteria 3377
121 Ga0501044_0644450 3300049823 Bacteria 949
122 nmdc:mga0k408_83109_c1 3300050493 Bacteria 1877
123 nmdc:mga07m45_116384_c1 3300050496 Bacteria 1200
124 Ga0500644_0005180 3300053088 Bacteria 3283
125 Ga0500594_0002377 3300053118 Bacteria 4091
126 Ga0500652_080106 3300053131 Bacteria 1359
127 Ga0500559_0000175 3300053136 Bacteria 50886
128 Ga0500622_0008143 3300053156 Bacteria 5890
129 Ga0500622_0106492 3300053156 Bacteria 1374
130 2548498300 2547132374 Bacteria 5530232
131 2643867570 2643221570 Bacteria 5103772
132 2643990495 2643221596 Bacteria 5006805
133 2644062957 2643221609 Bacteria 6756331
134 2644070640 2643221611 Bacteria 6820941
135 2644220869 2643221639 Bacteria 6649903
136 2644294989 2643221652 Bacteria 5140275
137 2644340156 2643221660 Bacteria 4208257
138 2644648834 2643221717 Bacteria 5676132
139 2739057285 2738541337 Bacteria 6183410
140 2739243732 2738543012 Bacteria 7115078
141 2816472571 2816332133 Bacteria 7249298
142 2886850567 2886848708 Bacteria 5632523
143 2894026669 2894023352 Bacteria 5167372
144 2990713103 2990710928 Bacteria 5002431
145 Ga0265316_10000126
146 Ga0055524_1000703
147 Ga0055531_10006311
148 Ga0055531_10055251
149 Ga0055543_1016934
150 Ga0065165_1000613
151 Ga0070676_10015506
152 Ga0070670_100034171
153 Ga0070677_10012211
154 Ga0068869_100013338
155 Ga0070666_10222175
156 Ga0070675_100117096
157 Ga0070673_100013397
158 Ga0070673_100914464
159 Ga0070667_100038959
160 Ga0070667_100962894
161 Ga0070678_100520977
162 Ga0068867_100003273
163 Ga0068867_100218764
164 Ga0070672_100008225
165 Ga0070672_100030343
166 Ga0070665_100772738
167 Ga0070665_100786489
168 Ga0068857_100418844
169 Ga0068859_100260340
170 Ga0068864_100193078
171 Ga0068864_100458655
172 Ga0075366_10042674
173 Ga0075366_10258515
174 Ga0075370_10116038
175 Ga0075370_10489428
176 Ga0075429_100001289
177 Ga0097620_100260339
178 Ga0105240_10113763
179 Ga0105241_10413426
180 Ga0105248_10014513
181 Ga0105237_10006384
182 Ga0105238_10079356
183 Ga0105239_10096538
184 Ga0157317_1004150
185 Ga0157319_1000010
186 Ga0157379_10920302
187 Ga0213872_10019131
188 Ga0209256_1001656
189 Ga0209257_1000578
190 Ga0209257_1012987
191 Ga0207645_10006011
192 Ga0207695_10083326
193 Ga0207671_10078357
194 Ga0207694_10052122
195 Ga0207650_10160598
196 Ga0207659_10428637
197 Ga0207690_10301671
198 Ga0207709_10377808
199 Ga0207691_10050580
200 Ga0207691_10096629
201 Ga0207689_10016772
202 Ga0207658_10031291
203 Ga0207658_10511263
204 Ga0207658_10761981
205 Ga0207648_10005753
206 Ga0207648_10254546
207 Ga0207674_10145356
208 Ga0209974_10018319
209 Ga0307515_10000026
210 Ga0307515_10153593
211 Ga0265328_10142503
212 Ga0265327_10000341
213 Ga0307513_10040754
214 Ga0307513_10119936
215 Ga0307509_10000041
216 Ga0307408_100003007
217 Ga0307408_100039583
218 Ga0307508_10339903
219 Ga0307516_10029729
220 Ga0307413_10635480
221 Ga0307406_10002339
222 Ga0307510_10118306
223 Ga0373940_0011490
224 Ga0373939_0000139
225 Ga0373962_0065183
226 Ga0373931_0000908
227 Ga0373937_0245758
228 Ga0395905_0006177
229 Ga0395905_0056396
230 Ga0436361_0513759
231 Ga0439447_060147
232 Ga0451791_0601287
233 Ga0451807_0982942
234 Ga0450917_001520
235 Ga0450890_000536
236 Ga0450890_003410
237 Ga0450891_000192
238 Ga0439458_0043130
239 Ga0439459_0000871
240 Ga0451577_0085140
241 Ga0466972_0095663
242 Ga0453684_0209605
243 Ga0453684_1542043
244 Ga0466968_0012168
245 Ga0451576_0042247
246 Ga0451576_0134032
247 Ga0451576_0177186
248 Ga0451576_0469186
249 Ga0495592_0001070
250 Ga0495607_0053869
251 Ga0495606_0044439
252 Ga0495648_0109741
253 Ga0495686_0108167
254 Ga0495614_0072171
255 Ga0496104_0076702
256 Ga0496109_0526353
257 Ga0496112_0017304
258 Ga0496121_0052063
259 Ga0496124_0000487
260 Ga0501042_0227222
261 Ga0501075_0076627
262 Ga0501222_045865
263 Ga0501262_002357
264 Ga0501266_001164
265 Ga0501044_0644450
266 nmdc:mga0k408_83109_c1
267 nmdc:mga07m45_116384_c1
268 Ga0500644_0005180
269 Ga0500594_0002377
270 Ga0500652_080106
271 Ga0500559_0000175
272 Ga0500622_0008143
273 Ga0500622_0106492
274 2548498300
275 2643867570
276 2643990495
277 2644062957
278 2644070640
279 2644220869
280 2644294989
281 2644340156
282 2644648834
283 2739057285
284 2739243732
285 2816472571
286 2886850567
287 2894026669
288 2990713103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03350

UPF0114

Uncharacterized protein family, UPF0114

42

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zch-assembly1.cif.gz_B chmp2a-chmp3 heterodimer (410 angstrom diameter) 0.446 64 199
4am2-assembly1.cif.gz_A bacterioferritin from blastochloris viridis 0.4018 40 199
7vt2-assembly2.cif.gz_R azumapecten farreri ferritin 0.3989 38 202
3gvy-assembly1.cif.gz_B crystal structure of bacterioferritin from r.sphaeroides 0.397 42 198
4zl5-assembly1.cif.gz_F crystal structure of the pmftn variant e44h soaked in iron (45 min) 0.3968 41 192
ID Description Score Start End Superfamily
af_Q6DHJ4_1_94_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5815 134 204 1.20.58.80
af_P0AEW1_127_216_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5713 142 202 1.10.287.3510
af_Q9LH92_301_431_1.20.1250.10 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.528 63 166 1.20.1250.10
af_I1K847_9_110_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5136 121 192 1.20.58.90
af_I1MXJ2_9_110_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.513 121 192 1.20.58.90
ID Description Score Start End GO Terms
AF-A0A4Q3LIS9-F1-model_v4 UPF0114 protein EOO30_08625 0.8339 20 204 GO:0005886
AF-A0A068YN11-F1-model_v4 UPF0114 protein 0.8333 20 202 GO:0005886
AF-A0A068YN11-F1-model_v4 UPF0114 protein 0.8218 20 202 GO:0005886
AF-A0A6P3CFN0-F1-model_v4 UPF0114 protein BLA6863_06883 0.8213 26 204 GO:0005886
AF-A0A6N8S2U6-F1-model_v4 deleted 0.8096 16 196

Map