F191630

General Info

Members Datasets Scaffolds Average Seq Length
144 112 288 403

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10041567|Ga0105248_100415672
Length 445
Sequence MLAARCGAMVSGIAGFSSRGIRGQGGMAPDGRPGKLERRMRDANGAQPTGPLRGLRVFDLTRVLAGPTCAQMLADLGADVIKIERPGAGDDTRGFAPPYMQGTRESAYFVGVNRNKRSVTLDIARPEGQAIARQLIAQSDILVENFKVGALAKYGLGYEELHAAYPRLIYCSITGFGQTGPYAPRPGYDSLIQAMGGVMSLTGEPDGLPQKVGVPVADLFAGLYGCIGILAALRHRDATGQGQQIDIGMLDTHVAWLANQGMNYLATGENPARLGNQHPNIVPYQVFPTADGYIVLSIGNDPTFKRFCEAFALTHLLEDARFATNAARVENRQLVTDTLTPVMQTQPTNWWVAKLEALKIGCGPINRLSEVPAEPHVVARGVVREMVHGSGETVKVIANPVRLSETPADYRLAPPLLGEHTDAVLGERLGLTASQLAGLREQGVI

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
8 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
9 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
30 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
40 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
45 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
46 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
47 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
48 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
49 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
50 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
51 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
52 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
53 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
54 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
55 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
64 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
67 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
79 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
80 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
88 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
102 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
103 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
104 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
105 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
106 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
107 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
108 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
109 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
110 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
111 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
112 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 0
Isolates 5.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.86
Nodule 0
Rhizoplane 1.39
Rhizosphere 77.78
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10041567 3300009177 Bacteria 5154
2 JGI25406J46586_10032268 3300003203 Bacteria 1947
3 Ga0070714_100037469 3300005435 Bacteria 4075
4 Ga0070713_100032627 3300005436 Bacteria 4162
5 Ga0070713_100089243 3300005436 Bacteria 2648
6 Ga0070713_100308690 3300005436 Bacteria 1458
7 Ga0070713_100415342 3300005436 Bacteria 1259
8 Ga0070678_100091367 3300005456 Bacteria 2336
9 Ga0068855_100012405 3300005563 Bacteria 10292
10 Ga0070702_100050564 3300005615 Bacteria 2375
11 Ga0068864_100039515 3300005618 Bacteria 4033
12 Ga0068860_100031982 3300005843 Bacteria 5058
13 Ga0081539_10000634 3300005985 Bacteria 71135
14 Ga0081539_10002783 3300005985 Bacteria 23498
15 Ga0070717_10013963 3300006028 Bacteria 6168
16 Ga0070717_10090076 3300006028 Bacteria 2588
17 Ga0075366_10022812 3300006195 Bacteria 3644
18 Ga0075428_100006043 3300006844 Bacteria 13448
19 Ga0075431_100000818 3300006847 Bacteria 27162
20 Ga0075429_100018237 3300006880 Bacteria 6076
21 Ga0099794_10003757 3300007265 Bacteria 5850
22 Ga0105240_10015892 3300009093 Bacteria 10210
23 Ga0105240_10238542 3300009093 Bacteria 2109
24 Ga0111539_10021369 3300009094 Bacteria 7967
25 Ga0105245_10200986 3300009098 Bacteria 1914
26 Ga0105245_10249999 3300009098 Bacteria 1722
27 Ga0114129_10220621 3300009147 Bacteria 2558
28 Ga0105238_10081231 3300009551 Bacteria 3231
29 Ga0105239_10097150 3300010375 Bacteria 3255
30 Ga0157370_10065771 3300013104 Bacteria 3430
31 Ga0157369_10006563 3300013105 Bacteria 13462
32 Ga0163162_10090260 3300013306 Bacteria 3145
33 Ga0157372_10061837 3300013307 Bacteria 4194
34 Ga0163163_10129177 3300014325 Bacteria 2567
35 Ga0157376_10021995 3300014969 Bacteria 4962
36 Ga0213874_10015633 3300021377 Bacteria 2005
37 Ga0213874_10020225 3300021377 Bacteria 1822
38 Ga0213875_10003298 3300021388 Bacteria 9234
39 Ga0207687_10289620 3300025927 Bacteria 1316
40 Ga0207664_10031007 3300025929 Bacteria 4087
41 Ga0207667_10041371 3300025949 Bacteria 4902
42 Ga0207702_10099961 3300026078 Bacteria 2558
43 Ga0207648_10277319 3300026089 Bacteria 1499
44 Ga0207683_10129913 3300026121 Bacteria 2265
45 Ga0307517_10075013 3300028786 Unclassified 2973
46 Ga0265338_10042579 3300028800 Bacteria 4226
47 Ga0265342_10051694 3300031712 Bacteria 2451
48 Ga0307405_10101686 3300031731 Bacteria 1929
49 Ga0307410_10152369 3300031852 Bacteria 1723
50 Ga0307406_10252277 3300031901 Bacteria 1330
51 Ga0307412_10060153 3300031911 Bacteria 2549
52 Ga0307510_10001032 3300033180 Bacteria 29518
53 Ga0307510_10056069 3300033180 Bacteria 4108
54 Ga0373953_0012339 3300035117 Bacteria 3024
55 Ga0373956_0076603 3300035119 Bacteria 1531
56 Ga0373943_0043559 3300035170 Bacteria 2180
57 Ga0373943_0076856 3300035170 Bacteria 1704
58 Ga0373955_0011257 3300035172 Bacteria 4255
59 Ga0316574_0205570 3300035398 Bacteria 1264
60 Ga0373935_0058441 3300035692 Bacteria 2463
61 Ga0373927_0026289 3300035695 Bacteria 3803
62 Ga0373927_0044856 3300035695 Bacteria 2860
63 Ga0373933_0005488 3300035724 Bacteria 6909
64 Ga0373933_0006806 3300035724 Bacteria 6228
65 Ga0373937_0008421 3300036401 Bacteria 8964
66 Ga0373937_0029555 3300036401 Bacteria 4964
67 Ga0373937_0099440 3300036401 Bacteria 2698
68 Ga0316584_0010488 3300036712 Bacteria 6477
69 Ga0373925_0012607 3300037068 Bacteria 6124
70 Ga0395900_0448769 3300037418 Bacteria 1246
71 Ga0395900_0497239 3300037418 Bacteria 1170
72 Ga0395898_0023501 3300037466 Bacteria 6227
73 Ga0395898_0285377 3300037466 Bacteria 1574
74 Ga0436364_0437662 3300037853 Bacteria 5100
75 Ga0436364_0524676 3300037853 Bacteria 42052
76 Ga0436364_0553476 3300037853 Bacteria 13870
77 Ga0436364_0953077 3300037853 Bacteria 4672
78 Ga0436364_1388831 3300037853 Bacteria 2131
79 Ga0436364_1503095 3300037853 Bacteria 20513
80 Ga0395901_0019848 3300038443 Bacteria 6875
81 Ga0436365_0221711 3300039437 Bacteria 1345
82 Ga0436365_0495360 3300039437 Bacteria 2367
83 Ga0436365_1893317 3300039437 Bacteria 2063
84 Ga0436360_0138166 3300039438 Bacteria 4060
85 Ga0436360_1018694 3300039438 Bacteria 6728
86 Ga0436361_0214351 3300039447 Bacteria 13072
87 Ga0436361_0215171 3300039447 Bacteria 3199
88 Ga0436363_1039850 3300039450 Bacteria 3837
89 Ga0436363_1534246 3300039450 Bacteria 1822
90 Ga0436362_0990823 3300039453 Bacteria 3430
91 Ga0451576_0000770 3300045051 Bacteria 63137
92 Ga0495590_0004816 3300046457 Bacteria 5407
93 Ga0495650_0003604 3300046471 Bacteria 11158
94 Ga0495664_0003861 3300046477 Bacteria 8176
95 Ga0495596_0000079 3300046500 Bacteria 66938
96 Ga0495608_0016014 3300046511 Bacteria 5190
97 Ga0495608_0139571 3300046511 Bacteria 1547
98 Ga0495632_0004161 3300046519 Bacteria 9919
99 Ga0495652_0047673 3300046529 Bacteria 3674
100 Ga0495640_0171520 3300046533 Bacteria 1386
101 Ga0495645_0011976 3300046543 Bacteria 6111
102 Ga0495622_0056097 3300046557 Bacteria 1827
103 Ga0495657_0044910 3300046675 Bacteria 3001
104 Ga0495657_0064744 3300046675 Bacteria 2406
105 Ga0495599_0013715 3300046678 Bacteria 5011
106 Ga0495599_0103450 3300046678 Bacteria 1774
107 Ga0495669_0003238 3300046684 Bacteria 6699
108 Ga0495649_0001920 3300046694 Bacteria 15144
109 Ga0495600_0072193 3300046809 Bacteria 2255
110 Ga0495604_0008968 3300047317 Bacteria 7908
111 Ga0495680_0150957 3300047322 Bacteria 1694
112 Ga0495687_001187 3300047443 Bacteria 25022
113 Ga0495686_0131587 3300047472 Bacteria 1483
114 Ga0495602_0027058 3300048088 Bacteria 5522
115 Ga0496112_0146916 3300048915 Bacteria 2326
116 Ga0496114_0019411 3300048917 Bacteria 5508
117 Ga0496119_0010188 3300048922 Bacteria 7937
118 Ga0501033_0042999 3300049570 Bacteria 3366
119 Ga0501037_0062615 3300049573 Bacteria 2712
120 Ga0501080_0152221 3300049742 Bacteria 2137
121 Ga0501044_0026691 3300049823 Bacteria 6113
122 Ga0501044_0057212 3300049823 Bacteria 4002
123 nmdc:mga0yw44_321172_c1 3300050492 Bacteria 1039
124 nmdc:mga0k408_6319_c1 3300050493 Bacteria 6322
125 nmdc:mga05p37_258703_c1 3300050507 Bacteria 2084
126 nmdc:mga09592_19562_c1 3300050508 Bacteria 3352
127 nmdc:mga0qj67_89177_c1 3300050509 Bacteria 2476
128 nmdc:mga08y16_100196_c1 3300050511 Bacteria 3016
129 nmdc:mga0n895_197247_c1 3300050512 Bacteria 2044
130 nmdc:mga0a205_141151_c1 3300050515 Bacteria 2309
131 nmdc:mga0sz30_8595_c1 3300050516 Bacteria 2872
132 Ga0495612_0003798 3300053078 Bacteria 6278
133 Ga0495619_0064892 3300053085 Bacteria 2435
134 Ga0500588_0014091 3300053146 Bacteria 2018
135 Ga0500616_0000436 3300053153 Bacteria 55137
136 Ga0500599_002125 3300053736 Bacteria 2353
137 2842778294 2842775625 Bacteria 5587290
138 2883579669 2883577096 Bacteria 4709178
139 2894775250 2894772417 Bacteria 5305674
140 2895515782 2895511927 Bacteria 6802080
141 2929202647 2929199973 Bacteria 7260745
142 2929206133 2929199973 Bacteria 7260745
143 8055910219 8055909800 Bacteria 7278581
144 8055912646 8055909800 Bacteria 7278581
145 Ga0105248_10041567
146 JGI25406J46586_10032268
147 Ga0070714_100037469
148 Ga0070713_100032627
149 Ga0070713_100089243
150 Ga0070713_100308690
151 Ga0070713_100415342
152 Ga0070678_100091367
153 Ga0068855_100012405
154 Ga0070702_100050564
155 Ga0068864_100039515
156 Ga0068860_100031982
157 Ga0081539_10000634
158 Ga0081539_10002783
159 Ga0070717_10013963
160 Ga0070717_10090076
161 Ga0075366_10022812
162 Ga0075428_100006043
163 Ga0075431_100000818
164 Ga0075429_100018237
165 Ga0099794_10003757
166 Ga0105240_10015892
167 Ga0105240_10238542
168 Ga0111539_10021369
169 Ga0105245_10200986
170 Ga0105245_10249999
171 Ga0114129_10220621
172 Ga0105238_10081231
173 Ga0105239_10097150
174 Ga0157370_10065771
175 Ga0157369_10006563
176 Ga0163162_10090260
177 Ga0157372_10061837
178 Ga0163163_10129177
179 Ga0157376_10021995
180 Ga0213874_10015633
181 Ga0213874_10020225
182 Ga0213875_10003298
183 Ga0207687_10289620
184 Ga0207664_10031007
185 Ga0207667_10041371
186 Ga0207702_10099961
187 Ga0207648_10277319
188 Ga0207683_10129913
189 Ga0307517_10075013
190 Ga0265338_10042579
191 Ga0265342_10051694
192 Ga0307405_10101686
193 Ga0307410_10152369
194 Ga0307406_10252277
195 Ga0307412_10060153
196 Ga0307510_10001032
197 Ga0307510_10056069
198 Ga0373953_0012339
199 Ga0373956_0076603
200 Ga0373943_0043559
201 Ga0373943_0076856
202 Ga0373955_0011257
203 Ga0316574_0205570
204 Ga0373935_0058441
205 Ga0373927_0026289
206 Ga0373927_0044856
207 Ga0373933_0005488
208 Ga0373933_0006806
209 Ga0373937_0008421
210 Ga0373937_0029555
211 Ga0373937_0099440
212 Ga0316584_0010488
213 Ga0373925_0012607
214 Ga0395900_0448769
215 Ga0395900_0497239
216 Ga0395898_0023501
217 Ga0395898_0285377
218 Ga0436364_0437662
219 Ga0436364_0524676
220 Ga0436364_0553476
221 Ga0436364_0953077
222 Ga0436364_1388831
223 Ga0436364_1503095
224 Ga0395901_0019848
225 Ga0436365_0221711
226 Ga0436365_0495360
227 Ga0436365_1893317
228 Ga0436360_0138166
229 Ga0436360_1018694
230 Ga0436361_0214351
231 Ga0436361_0215171
232 Ga0436363_1039850
233 Ga0436363_1534246
234 Ga0436362_0990823
235 Ga0451576_0000770
236 Ga0495590_0004816
237 Ga0495650_0003604
238 Ga0495664_0003861
239 Ga0495596_0000079
240 Ga0495608_0016014
241 Ga0495608_0139571
242 Ga0495632_0004161
243 Ga0495652_0047673
244 Ga0495640_0171520
245 Ga0495645_0011976
246 Ga0495622_0056097
247 Ga0495657_0044910
248 Ga0495657_0064744
249 Ga0495599_0013715
250 Ga0495599_0103450
251 Ga0495669_0003238
252 Ga0495649_0001920
253 Ga0495600_0072193
254 Ga0495604_0008968
255 Ga0495680_0150957
256 Ga0495687_001187
257 Ga0495686_0131587
258 Ga0495602_0027058
259 Ga0496112_0146916
260 Ga0496114_0019411
261 Ga0496119_0010188
262 Ga0501033_0042999
263 Ga0501037_0062615
264 Ga0501080_0152221
265 Ga0501044_0026691
266 Ga0501044_0057212
267 nmdc:mga0yw44_321172_c1
268 nmdc:mga0k408_6319_c1
269 nmdc:mga05p37_258703_c1
270 nmdc:mga09592_19562_c1
271 nmdc:mga0qj67_89177_c1
272 nmdc:mga08y16_100196_c1
273 nmdc:mga0n895_197247_c1
274 nmdc:mga0a205_141151_c1
275 nmdc:mga0sz30_8595_c1
276 Ga0495612_0003798
277 Ga0495619_0064892
278 Ga0500588_0014091
279 Ga0500616_0000436
280 Ga0500599_002125
281 2842778294
282 2883579669
283 2894775250
284 2895515782
285 2929202647
286 2929206133
287 8055910219
288 8055912646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

52

421

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9474 5 385
5yx6-assembly2.cif.gz_C crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9459 6 378
5yit-assembly2.cif.gz_C crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9429 6 380
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9428 6 380
5yx6-assembly1.cif.gz_B crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.942 6 380
ID Description Score Start End Superfamily
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9752 232 323 3.30.1540.10
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9737 28 242 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9702 5 289 3.40.50.10540
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9668 5 289 3.40.50.10540
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.965 232 323 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A349SF27-F1-model_v4 CoA transferase 0.9882 144 278 GO:0008410
AF-A0A1F9DFM9-F1-model_v4 Formyl-CoA transferase 0.9864 6 402 GO:0008410
AF-A0A4Y7RW99-F1-model_v4 Acetyl-CoA:oxalate CoA-transferase (EC 2.8.3.19) 0.9824 5 401 GO:0008410
AF-A0A7W7Q1P1-F1-model_v4 Formyl-CoA transferase (EC 2.8.3.16) 0.9823 6 401 GO:0033608
AF-A0A3L7VS60-F1-model_v4 CoA transferase 0.9817 5 402 GO:0008410

Map