F190176

General Info

Members Datasets Scaffolds Average Seq Length
143 95 286 140

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0235962|Ga0530510_0235962_716_1234
Length 172
Sequence MKSHREELTFNIPARMDFVNITPQVQAAVKRSGVKDGLCLVNAMHITASVFINDDEPGLHEDYKRWLEELAPFDPSPARYHHNRTGEDNADAHHKRQIMGREVVVAITEGKLDFGPWEQIFYGEFDGRRPKRVLIKIIGAKPASAVYRAGTEMRPPVRDRDGQSDRPGWIPG

Samples

Sample ID Description Type Environment
1 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
33 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
34 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
54 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
55 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
61 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
62 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
63 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
64 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
93 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
94 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
95 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0530510_0235962 3300061734 Bacteria 1361
2 Ga0065704_10181034 3300005289 Bacteria 1221
3 Ga0065715_10889272 3300005293 Bacteria 565
4 Ga0065707_10086157 3300005295 Bacteria 5628
5 Ga0070666_10043501 3300005335 Bacteria 3008
6 Ga0070688_101130637 3300005365 Bacteria 627
7 Ga0070703_10271742 3300005406 Bacteria 696
8 Ga0070713_100708774 3300005436 Bacteria 961
9 Ga0070708_100173092 3300005445 Bacteria 2016
10 Ga0070706_100209445 3300005467 Bacteria 1820
11 Ga0070707_100329934 3300005468 Bacteria 1482
12 Ga0070707_102090862 3300005468 Bacteria 534
13 Ga0070698_100456184 3300005471 Bacteria 1214
14 Ga0070698_100648531 3300005471 Bacteria 997
15 Ga0070698_101129150 3300005471 Bacteria 732
16 Ga0070697_100195045 3300005536 Bacteria 1720
17 Ga0070686_100192915 3300005544 Bacteria 1455
18 Ga0070704_100095451 3300005549 Bacteria 2227
19 Ga0068855_100127823 3300005563 Bacteria 2904
20 Ga0068855_100324945 3300005563 Bacteria 1699
21 Ga0068856_100098588 3300005614 Bacteria 2913
22 Ga0068852_101199359 3300005616 Bacteria 780
23 Ga0068860_100078648 3300005843 Bacteria 3136
24 Ga0068860_100444609 3300005843 Bacteria 1288
25 Ga0075428_100013811 3300006844 Bacteria 8993
26 Ga0075428_100041955 3300006844 Bacteria 5031
27 Ga0075431_100176568 3300006847 Bacteria 2194
28 Ga0075429_100463045 3300006880 Bacteria 1111
29 Ga0105240_10021626 3300009093 Bacteria 8555
30 Ga0111539_10434375 3300009094 Bacteria 1529
31 Ga0111539_11421317 3300009094 Bacteria 805
32 Ga0105245_12601436 3300009098 Bacteria 559
33 Ga0114129_11068908 3300009147 Bacteria 1012
34 Ga0114129_12236230 3300009147 Bacteria 657
35 Ga0157373_11002611 3300013100 Bacteria 623
36 Ga0157373_11537588 3300013100 Bacteria 509
37 Ga0157370_10106593 3300013104 Bacteria 2622
38 Ga0157369_10065545 3300013105 Bacteria 3909
39 Ga0157375_11922284 3300013308 Bacteria 703
40 Ga0157380_11201167 3300014326 Bacteria 802
41 Ga0213873_10048064 3300021358 Bacteria 1121
42 Ga0213872_10062199 3300021361 Bacteria 1687
43 Ga0207653_10153844 3300025885 Bacteria 848
44 Ga0207692_10215013 3300025898 Bacteria 1137
45 Ga0207642_10902524 3300025899 Bacteria 566
46 Ga0207680_10026299 3300025903 Bacteria 3224
47 Ga0207684_10036821 3300025910 Bacteria 4152
48 Ga0207707_11227420 3300025912 Bacteria 606
49 Ga0207695_10000126 3300025913 Bacteria 228511
50 Ga0207663_10093718 3300025916 Bacteria 1999
51 Ga0207646_10021100 3300025922 Bacteria 6024
52 Ga0207664_11089623 3300025929 Bacteria 714
53 Ga0207704_10611398 3300025938 Bacteria 893
54 Ga0207689_10042730 3300025942 Bacteria 3748
55 Ga0207667_10176863 3300025949 Bacteria 2192
56 Ga0207667_10176873 3300025949 Bacteria 2192
57 Ga0207698_10355168 3300026142 Bacteria 1386
58 Ga0268264_11255728 3300028381 Bacteria 751
59 Ga0265338_10012373 3300028800 Bacteria 9729
60 Ga0265316_10265673 3300031344 Bacteria 1257
61 Ga0307513_10432917 3300031456 Bacteria 1043
62 Ga0307408_101973432 3300031548 Bacteria 561
63 Ga0265313_10066124 3300031595 Bacteria 1677
64 Ga0316575_10110537 3300031665 Bacteria 1121
65 Ga0316579_10018855 3300031691 Bacteria 3041
66 Ga0265314_10272639 3300031711 Bacteria 961
67 Ga0316576_10004207 3300031727 Bacteria 8597
68 Ga0316576_10028734 3300031727 Bacteria 3923
69 Ga0316576_10091795 3300031727 Bacteria 2263
70 Ga0316576_10104930 3300031727 Bacteria 2115
71 Ga0316576_10111244 3300031727 Bacteria 2053
72 Ga0316578_10106698 3300031728 Bacteria 1681
73 Ga0316578_10117940 3300031728 Bacteria 1595
74 Ga0316578_10226466 3300031728 Bacteria 1123
75 Ga0316578_10288617 3300031728 Bacteria 982
76 Ga0316578_10738454 3300031728 Bacteria 572
77 Ga0316577_10003638 3300031733 Bacteria 7827
78 Ga0316577_10200254 3300031733 Bacteria 1128
79 Ga0316583_10005787 3300032133 Bacteria 4444
80 Ga0316585_10087864 3300032137 Bacteria 1015
81 Ga0316580_10206025 3300032139 Bacteria 606
82 Ga0373955_0318048 3300035172 Bacteria 940
83 Ga0316574_0019322 3300035398 Bacteria 4017
84 Ga0316574_0188815 3300035398 Bacteria 1325
85 Ga0316574_0322575 3300035398 Bacteria 980
86 Ga0373937_0447486 3300036401 Bacteria 1227
87 Ga0316582_0072598 3300036647 Bacteria 2231
88 Ga0316582_0092700 3300036647 Bacteria 1991
89 Ga0316582_0272989 3300036647 Bacteria 1160
90 Ga0316584_0006037 3300036712 Bacteria 8186
91 Ga0316584_0029519 3300036712 Bacteria 4048
92 Ga0316584_0148352 3300036712 Bacteria 1747
93 Ga0316584_0983739 3300036712 Bacteria 564
94 Ga0400489_26566 3300039093 Bacteria 2660
95 Ga0436360_0070058 3300039438 Bacteria 4325
96 Ga0436360_0541796 3300039438 Bacteria 628
97 Ga0436360_0543972 3300039438 Bacteria 504
98 Ga0436360_0695911 3300039438 Bacteria 773
99 Ga0436361_0393504 3300039447 Bacteria 3984
100 Ga0436361_0560631 3300039447 Bacteria 587
101 Ga0436362_0331694 3300039453 Bacteria 663
102 Ga0451577_0000009 3300042876 Bacteria 646744
103 Ga0453683_0001525 3300044673 Bacteria 19761
104 Ga0453684_0000323 3300044712 Bacteria 202159
105 Ga0453684_0000513 3300044712 Bacteria 149882
106 Ga0453684_0000902 3300044712 Bacteria 99035
107 Ga0453684_0004845 3300044712 Bacteria 27625
108 Ga0453684_0013796 3300044712 Bacteria 13063
109 Ga0453684_0146707 3300044712 Bacteria 2809
110 Ga0451576_0001232 3300045051 Bacteria 45332
111 Ga0451576_0532044 3300045051 Bacteria 1235
112 Ga0495635_0934959 3300046663 Bacteria 554
113 Ga0496109_1720972 3300048912 Bacteria 561
114 Ga0501034_0987731 3300049571 Bacteria 726
115 Ga0501038_0854256 3300049574 Unclassified 674
116 Ga0501038_0864916 3300049574 Bacteria 669
117 Ga0501039_0368710 3300049575 Bacteria 1128
118 Ga0501040_1111275 3300049576 Bacteria 573
119 Ga0501071_0268678 3300049587 Archaea 1289
120 Ga0501072_0662325 3300049588 Bacteria 821
121 Ga0501072_1146029 3300049588 Bacteria 605
122 Ga0501075_0014120 3300049591 Archaea 5722
123 Ga0501075_0298325 3300049591 Bacteria 1228
124 Ga0501076_0054124 3300049592 Bacteria 3180
125 Ga0501076_0664091 3300049592 Bacteria 860
126 Ga0501079_0027192 3300049741 Unclassified 4385
127 Ga0501079_1621920 3300049741 Bacteria 509
128 Ga0501081_0001760 3300049743 Archaea 13426
129 Ga0501081_0345844 3300049743 Bacteria 1095
130 Ga0501044_0870334 3300049823 Bacteria 777
131 Ga0501045_0909307 3300049824 Bacteria 646
132 nmdc:mga05p37_1142782_c1 3300050507 Bacteria 811
133 nmdc:mga05p37_566856_c1 3300050507 Bacteria 1289
134 nmdc:mga06r32_2034388_c1 3300050510 Bacteria 508
135 Ga0495595_0735705 3300053084 Bacteria 506
136 Ga0501084_0009183 3300054114 Archaea 8176
137 Ga0501084_1320501 3300054114 Bacteria 604
138 Ga0590071_107506 3300059421 Bacteria 706
139 Ga0501082_0107910 3300060353 Archaea 2409
140 Ga0501082_0404653 3300060353 Bacteria 1191
141 Ga0501082_0778852 3300060353 Bacteria 837
142 Ga0530510_0037659 3300061734 Unclassified 3490
143 Ga0530510_1387354 3300061734 Bacteria 539
144 Ga0530510_0235962
145 Ga0065704_10181034
146 Ga0065715_10889272
147 Ga0065707_10086157
148 Ga0070666_10043501
149 Ga0070688_101130637
150 Ga0070703_10271742
151 Ga0070713_100708774
152 Ga0070708_100173092
153 Ga0070706_100209445
154 Ga0070707_100329934
155 Ga0070707_102090862
156 Ga0070698_100456184
157 Ga0070698_100648531
158 Ga0070698_101129150
159 Ga0070697_100195045
160 Ga0070686_100192915
161 Ga0070704_100095451
162 Ga0068855_100127823
163 Ga0068855_100324945
164 Ga0068856_100098588
165 Ga0068852_101199359
166 Ga0068860_100078648
167 Ga0068860_100444609
168 Ga0075428_100013811
169 Ga0075428_100041955
170 Ga0075431_100176568
171 Ga0075429_100463045
172 Ga0105240_10021626
173 Ga0111539_10434375
174 Ga0111539_11421317
175 Ga0105245_12601436
176 Ga0114129_11068908
177 Ga0114129_12236230
178 Ga0157373_11002611
179 Ga0157373_11537588
180 Ga0157370_10106593
181 Ga0157369_10065545
182 Ga0157375_11922284
183 Ga0157380_11201167
184 Ga0213873_10048064
185 Ga0213872_10062199
186 Ga0207653_10153844
187 Ga0207692_10215013
188 Ga0207642_10902524
189 Ga0207680_10026299
190 Ga0207684_10036821
191 Ga0207707_11227420
192 Ga0207695_10000126
193 Ga0207663_10093718
194 Ga0207646_10021100
195 Ga0207664_11089623
196 Ga0207704_10611398
197 Ga0207689_10042730
198 Ga0207667_10176863
199 Ga0207667_10176873
200 Ga0207698_10355168
201 Ga0268264_11255728
202 Ga0265338_10012373
203 Ga0265316_10265673
204 Ga0307513_10432917
205 Ga0307408_101973432
206 Ga0265313_10066124
207 Ga0316575_10110537
208 Ga0316579_10018855
209 Ga0265314_10272639
210 Ga0316576_10004207
211 Ga0316576_10028734
212 Ga0316576_10091795
213 Ga0316576_10104930
214 Ga0316576_10111244
215 Ga0316578_10106698
216 Ga0316578_10117940
217 Ga0316578_10226466
218 Ga0316578_10288617
219 Ga0316578_10738454
220 Ga0316577_10003638
221 Ga0316577_10200254
222 Ga0316583_10005787
223 Ga0316585_10087864
224 Ga0316580_10206025
225 Ga0373955_0318048
226 Ga0316574_0019322
227 Ga0316574_0188815
228 Ga0316574_0322575
229 Ga0373937_0447486
230 Ga0316582_0072598
231 Ga0316582_0092700
232 Ga0316582_0272989
233 Ga0316584_0006037
234 Ga0316584_0029519
235 Ga0316584_0148352
236 Ga0316584_0983739
237 Ga0400489_26566
238 Ga0436360_0070058
239 Ga0436360_0541796
240 Ga0436360_0543972
241 Ga0436360_0695911
242 Ga0436361_0393504
243 Ga0436361_0560631
244 Ga0436362_0331694
245 Ga0451577_0000009
246 Ga0453683_0001525
247 Ga0453684_0000323
248 Ga0453684_0000513
249 Ga0453684_0000902
250 Ga0453684_0004845
251 Ga0453684_0013796
252 Ga0453684_0146707
253 Ga0451576_0001232
254 Ga0451576_0532044
255 Ga0495635_0934959
256 Ga0496109_1720972
257 Ga0501034_0987731
258 Ga0501038_0854256
259 Ga0501038_0864916
260 Ga0501039_0368710
261 Ga0501040_1111275
262 Ga0501071_0268678
263 Ga0501072_0662325
264 Ga0501072_1146029
265 Ga0501075_0014120
266 Ga0501075_0298325
267 Ga0501076_0054124
268 Ga0501076_0664091
269 Ga0501079_0027192
270 Ga0501079_1621920
271 Ga0501081_0001760
272 Ga0501081_0345844
273 Ga0501044_0870334
274 Ga0501045_0909307
275 nmdc:mga05p37_1142782_c1
276 nmdc:mga05p37_566856_c1
277 nmdc:mga06r32_2034388_c1
278 Ga0495595_0735705
279 Ga0501084_0009183
280 Ga0501084_1320501
281 Ga0590071_107506
282 Ga0501082_0107910
283 Ga0501082_0404653
284 Ga0501082_0778852
285 Ga0530510_0037659
286 Ga0530510_1387354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

20

137

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9802 1 140
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9786 1 140
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9733 1 140
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9716 1 140
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9598 4 138
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9787 1 140 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9717 1 140 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9496 4 140 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9492 6 138 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9365 2 140 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A517Z1G6-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.996 2 140
AF-A0A142YKJ4-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9954 2 140
AF-A0A3M1Q255-F1-model_v4 YjbQ family protein 0.9934 14 140
AF-K5DCJ7-F1-model_v4 Protein belonging to uncharacterized protein family UPF0047 0.9924 2 140
AF-A0A2E7KD61-F1-model_v4 deleted 0.9894 12 140

Map