F189725

General Info

Members Datasets Scaffolds Average Seq Length
143 111 286 166

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0422665|Ga0495652_0422665_323_919
Length 198
Sequence MNETNPNIPLRGAPMALDSLRDLLIDELKDLYSAENQLLKALPKMAKAASHEDLKDAFTEHLEVTRGQVTRLDEIFEELEESPKGKKCKAMEGLVEEGSEVIGEDGEDAVKDAALIASAQRVEHYEMAGYGCVRTFASLLGLDDIAAKLQETLDEEREADKSLTELAESIINVEAEGADDEDASDAKNGRMKSKTKSK

Samples

Sample ID Description Type Environment
1 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
2 3300000305 Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly Metatranscriptome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
44 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
73 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
74 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
77 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
97 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
106 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
109 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
110 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
111 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 75.52
Metatranscriptomes 23.78
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 4.9
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 22.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495652_0422665 3300046529 Bacteria 939
2 bgg_mtDRAFT_1032136 3300000305 Unclassified 532
3 Ga0032354_1015256 3300003693 Unclassified 624
4 Ga0058863_11374467 3300004799 Bacteria 1008
5 Ga0058861_11274662 3300004800 Bacteria 536
6 Ga0058861_11420917 3300004800 Bacteria 1206
7 Ga0058860_10862546 3300004801 Unclassified 565
8 Ga0065712_10217495 3300005290 Bacteria 1052
9 Ga0065707_10400916 3300005295 Bacteria 853
10 Ga0070683_100275258 3300005329 Bacteria 1601
11 Ga0070690_100493336 3300005330 Unclassified 915
12 Ga0070690_100792949 3300005330 Bacteria 734
13 Ga0070680_100355888 3300005336 Bacteria 1245
14 Ga0070680_101019409 3300005336 Unclassified 715
15 Ga0070660_101440057 3300005339 Unclassified 585
16 Ga0070689_100038767 3300005340 Bacteria 3646
17 Ga0070689_101139253 3300005340 Unclassified 698
18 Ga0070687_100458790 3300005343 Bacteria 849
19 Ga0070668_100022154 3300005347 Unclassified 4803
20 Ga0070688_100848175 3300005365 Unclassified 717
21 Ga0070714_100019095 3300005435 Bacteria 5579
22 Ga0070713_100025497 3300005436 Bacteria 4623
23 Ga0070685_10688006 3300005466 Unclassified 744
24 Ga0070679_100240781 3300005530 Bacteria 1766
25 Ga0070679_100914439 3300005530 Bacteria 821
26 Ga0070684_100305174 3300005535 Unclassified 1461
27 Ga0070686_100326447 3300005544 Unclassified 1146
28 Ga0070717_10817014 3300006028 Bacteria 848
29 Ga0070717_10948188 3300006028 Bacteria 784
30 Ga0075365_10001624 3300006038 Bacteria 10375
31 Ga0070716_100367060 3300006173 Bacteria 1024
32 Ga0075366_10131733 3300006195 Bacteria 1509
33 Ga0097621_101158706 3300006237 Unclassified 727
34 Ga0075428_101192191 3300006844 Bacteria 803
35 Ga0075430_100020796 3300006846 Bacteria 5579
36 Ga0075430_100401923 3300006846 Bacteria 1131
37 Ga0075433_10022272 3300006852 Bacteria 5318
38 Ga0075429_100033479 3300006880 Bacteria 4465
39 Ga0075429_100630390 3300006880 Bacteria 939
40 Ga0097620_100861122 3300006931 Unclassified 992
41 Ga0105247_10254008 3300009101 Bacteria 1203
42 Ga0114129_10645381 3300009147 Bacteria 1367
43 Ga0114129_10683384 3300009147 Bacteria 1321
44 Ga0105242_11084892 3300009176 Bacteria 814
45 Ga0105248_10410771 3300009177 Bacteria 1524
46 Ga0105248_11328177 3300009177 Unclassified 813
47 Ga0105249_10000059 3300009553 Bacteria 154729
48 Ga0157380_10777003 3300014326 Bacteria 972
49 Ga0157376_10016910 3300014969 Bacteria 5551
50 Ga0197907_10478225 3300020069 Bacteria 672
51 Ga0206356_10610831 3300020070 Bacteria 646
52 Ga0206356_11638687 3300020070 Bacteria 814
53 Ga0206349_1300943 3300020075 Unclassified 525
54 Ga0206349_1616884 3300020075 Bacteria 667
55 Ga0206349_1790969 3300020075 Bacteria 531
56 Ga0206355_1202901 3300020076 Bacteria 674
57 Ga0206351_10467413 3300020077 Unclassified 564
58 Ga0206352_10393884 3300020078 Unclassified 819
59 Ga0206352_10820336 3300020078 Bacteria 674
60 Ga0206352_10940186 3300020078 Unclassified 693
61 Ga0206352_11012207 3300020078 Bacteria 722
62 Ga0206352_11219978 3300020078 Unclassified 891
63 Ga0206350_10063666 3300020080 Bacteria 670
64 Ga0206350_10688892 3300020080 Bacteria 545
65 Ga0206354_11354605 3300020081 Unclassified 539
66 Ga0206354_11584434 3300020081 Bacteria 668
67 Ga0206353_10141485 3300020082 Bacteria 600
68 Ga0206353_11234229 3300020082 Bacteria 658
69 Ga0206353_11303994 3300020082 Unclassified 524
70 Ga0206353_11481417 3300020082 Bacteria 666
71 Ga0206353_11791915 3300020082 Bacteria 589
72 Ga0154015_1280841 3300020610 Unclassified 963
73 Ga0154015_1493502 3300020610 Bacteria 722
74 Ga0224712_10133619 3300022467 Bacteria 1085
75 Ga0224712_10408350 3300022467 Bacteria 648
76 Ga0207707_10168789 3300025912 Bacteria 1912
77 Ga0207693_10227005 3300025915 Unclassified 1467
78 Ga0207660_10061887 3300025917 Unclassified 2695
79 Ga0207660_10144334 3300025917 Bacteria 1822
80 Ga0207652_10799719 3300025921 Bacteria 837
81 Ga0207700_10226692 3300025928 Bacteria 1587
82 Ga0207664_10078309 3300025929 Bacteria 2681
83 Ga0207644_10157865 3300025931 Bacteria 1761
84 Ga0207670_10087153 3300025936 Bacteria 2199
85 Ga0207691_10542494 3300025940 Unclassified 986
86 Ga0207711_11208618 3300025941 Unclassified 697
87 Ga0207712_10000047 3300025961 Bacteria 161425
88 Ga0207712_10471352 3300025961 Bacteria 1068
89 Ga0207668_10014883 3300025972 Unclassified 4823
90 Ga0268266_10002071 3300028379 Bacteria 22211
91 Ga0268265_10447737 3300028380 Bacteria 1205
92 Ga0265777_111445 3300030877 Unclassified 660
93 Ga0307408_101173478 3300031548 Bacteria 715
94 Ga0307407_10894128 3300031903 Bacteria 681
95 Ga0307416_100076330 3300032002 Bacteria 2808
96 Ga0307416_101316154 3300032002 Bacteria 828
97 Ga0373933_0108670 3300035724 Bacteria 1728
98 Ga0265778_040555 3300036457 Bacteria 620
99 Ga0373925_0179827 3300037068 Bacteria 1673
100 Ga0451795_0967702 3300041456 Unclassified 850
101 Ga0439431_0033167 3300041997 Bacteria 1290
102 Ga0439435_0018111 3300042436 Bacteria 1789
103 Ga0466961_0114605 3300044693 Bacteria 1694
104 Ga0495587_0141172 3300046536 Bacteria 1375
105 Ga0495604_1049132 3300047317 Bacteria 502
106 Ga0495686_0589167 3300047472 Bacteria 577
107 Ga0495602_0226089 3300048088 Bacteria 1409
108 Ga0496101_1097126 3300048904 Bacteria 625
109 Ga0496105_0014082 3300048908 Bacteria 6364
110 Ga0496106_0402778 3300048909 Bacteria 1100
111 Ga0496110_0636774 3300048913 Unclassified 966
112 Ga0496111_0205750 3300048914 Bacteria 1463
113 Ga0496115_1031521 3300048918 Bacteria 627
114 Ga0501034_0742778 3300049571 Bacteria 877
115 Ga0501038_0624989 3300049574 Bacteria 813
116 Ga0501039_0213950 3300049575 Bacteria 1516
117 Ga0501046_0143151 3300049580 Bacteria 1808
118 Ga0501046_0408518 3300049580 Unclassified 980
119 Ga0501048_0533165 3300049582 Bacteria 842
120 Ga0501068_0747632 3300049584 Bacteria 640
121 Ga0501071_0687876 3300049587 Bacteria 787
122 Ga0501072_0795525 3300049588 Bacteria 741
123 Ga0501074_0599536 3300049590 Bacteria 779
124 Ga0501076_0161560 3300049592 Bacteria 1825
125 Ga0501077_0026842 3300049593 Bacteria 3656
126 Ga0501259_082510 3300049688 Bacteria 709
127 Ga0501045_0060065 3300049824 Bacteria 2786
128 nmdc:mga0yw44_179562_c1 3300050492 Bacteria 1393
129 nmdc:mga05p37_1106792_c1 3300050507 Bacteria 829
130 nmdc:mga09592_47392_c1 3300050508 Bacteria 3622
131 nmdc:mga0qj67_113004_c1 3300050509 Bacteria 2193
132 nmdc:mga0qj67_25281_c1 3300050509 Bacteria 4587
133 nmdc:mga0qj67_698425_c1 3300050509 Bacteria 807
134 nmdc:mga06r32_211539_c1 3300050510 Bacteria 1927
135 Ga0495601_0364522 3300053077 Bacteria 939
136 Ga0495601_0525684 3300053077 Bacteria 762
137 Ga0495619_0194613 3300053085 Bacteria 1404
138 Ga0500594_0084953 3300053118 Bacteria 952
139 Ga0501084_0060701 3300054114 Bacteria 3165
140 Ga0590074_000871 3300059423 Bacteria 4690
141 Ga0590075_000325 3300059424 Bacteria 13243
142 Ga0590077_000418 3300059426 Bacteria 11885
143 2688065732 2687453257 Bacteria 6784659
144 Ga0495652_0422665
145 bgg_mtDRAFT_1032136
146 Ga0032354_1015256
147 Ga0058863_11374467
148 Ga0058861_11274662
149 Ga0058861_11420917
150 Ga0058860_10862546
151 Ga0065712_10217495
152 Ga0065707_10400916
153 Ga0070683_100275258
154 Ga0070690_100493336
155 Ga0070690_100792949
156 Ga0070680_100355888
157 Ga0070680_101019409
158 Ga0070660_101440057
159 Ga0070689_100038767
160 Ga0070689_101139253
161 Ga0070687_100458790
162 Ga0070668_100022154
163 Ga0070688_100848175
164 Ga0070714_100019095
165 Ga0070713_100025497
166 Ga0070685_10688006
167 Ga0070679_100240781
168 Ga0070679_100914439
169 Ga0070684_100305174
170 Ga0070686_100326447
171 Ga0070717_10817014
172 Ga0070717_10948188
173 Ga0075365_10001624
174 Ga0070716_100367060
175 Ga0075366_10131733
176 Ga0097621_101158706
177 Ga0075428_101192191
178 Ga0075430_100020796
179 Ga0075430_100401923
180 Ga0075433_10022272
181 Ga0075429_100033479
182 Ga0075429_100630390
183 Ga0097620_100861122
184 Ga0105247_10254008
185 Ga0114129_10645381
186 Ga0114129_10683384
187 Ga0105242_11084892
188 Ga0105248_10410771
189 Ga0105248_11328177
190 Ga0105249_10000059
191 Ga0157380_10777003
192 Ga0157376_10016910
193 Ga0197907_10478225
194 Ga0206356_10610831
195 Ga0206356_11638687
196 Ga0206349_1300943
197 Ga0206349_1616884
198 Ga0206349_1790969
199 Ga0206355_1202901
200 Ga0206351_10467413
201 Ga0206352_10393884
202 Ga0206352_10820336
203 Ga0206352_10940186
204 Ga0206352_11012207
205 Ga0206352_11219978
206 Ga0206350_10063666
207 Ga0206350_10688892
208 Ga0206354_11354605
209 Ga0206354_11584434
210 Ga0206353_10141485
211 Ga0206353_11234229
212 Ga0206353_11303994
213 Ga0206353_11481417
214 Ga0206353_11791915
215 Ga0154015_1280841
216 Ga0154015_1493502
217 Ga0224712_10133619
218 Ga0224712_10408350
219 Ga0207707_10168789
220 Ga0207693_10227005
221 Ga0207660_10061887
222 Ga0207660_10144334
223 Ga0207652_10799719
224 Ga0207700_10226692
225 Ga0207664_10078309
226 Ga0207644_10157865
227 Ga0207670_10087153
228 Ga0207691_10542494
229 Ga0207711_11208618
230 Ga0207712_10000047
231 Ga0207712_10471352
232 Ga0207668_10014883
233 Ga0268266_10002071
234 Ga0268265_10447737
235 Ga0265777_111445
236 Ga0307408_101173478
237 Ga0307407_10894128
238 Ga0307416_100076330
239 Ga0307416_101316154
240 Ga0373933_0108670
241 Ga0265778_040555
242 Ga0373925_0179827
243 Ga0451795_0967702
244 Ga0439431_0033167
245 Ga0439435_0018111
246 Ga0466961_0114605
247 Ga0495587_0141172
248 Ga0495604_1049132
249 Ga0495686_0589167
250 Ga0495602_0226089
251 Ga0496101_1097126
252 Ga0496105_0014082
253 Ga0496106_0402778
254 Ga0496110_0636774
255 Ga0496111_0205750
256 Ga0496115_1031521
257 Ga0501034_0742778
258 Ga0501038_0624989
259 Ga0501039_0213950
260 Ga0501046_0143151
261 Ga0501046_0408518
262 Ga0501048_0533165
263 Ga0501068_0747632
264 Ga0501071_0687876
265 Ga0501072_0795525
266 Ga0501074_0599536
267 Ga0501076_0161560
268 Ga0501077_0026842
269 Ga0501259_082510
270 Ga0501045_0060065
271 nmdc:mga0yw44_179562_c1
272 nmdc:mga05p37_1106792_c1
273 nmdc:mga09592_47392_c1
274 nmdc:mga0qj67_113004_c1
275 nmdc:mga0qj67_25281_c1
276 nmdc:mga0qj67_698425_c1
277 nmdc:mga06r32_211539_c1
278 Ga0495601_0364522
279 Ga0495601_0525684
280 Ga0495619_0194613
281 Ga0500594_0084953
282 Ga0501084_0060701
283 Ga0590074_000871
284 Ga0590075_000325
285 Ga0590077_000418
286 2688065732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05974

DUF892

Domain of unknown function (DUF892)

19

176

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gyq-assembly1.cif.gz_B ycfi, a putative structural protein from rhodopseudomonas palustris. 0.9691 2 151
4eru-assembly1.cif.gz_B crystal structure of putative cytoplasmic protein, ycif bacterial stress response protein from salmonella enterica 0.9649 3 154
7tmv-assembly1.cif.gz_B crystal structure of a putative structural protein from klebsiella pneumoniae 0.9637 3 154
2gs4-assembly1.cif.gz_A the crystal structure of the e.coli stress protein ycif. 0.9611 4 159
7tmv-assembly1.cif.gz_B crystal structure of a putative structural protein from klebsiella pneumoniae 0.9396 3 154
ID Description Score Start End Superfamily
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9692 2 151 1.20.1260.10
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9672 2 157 1.20.1260.10
4eruA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9393 2 154 1.20.1260.10
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9263 2 157 1.20.1260.10
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9212 2 151 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7V8VTU4-F1-model_v4 Ferritin-like domain-containing protein 0.9952 1 119
AF-A0A2V7YDE0-F1-model_v4 Uncharacterized protein 0.9898 3 100
AF-A0A1Q5PH10-F1-model_v4 Uncharacterized protein 0.9875 3 163
AF-A0A7V9QGI5-F1-model_v4 Ferritin-like domain-containing protein 0.9871 3 163
AF-A0A2V5WBC7-F1-model_v4 Ferritin-like domain-containing protein 0.987 3 144

Map