F189515

General Info

Members Datasets Scaffolds Average Seq Length
143 64 143 302

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0002359|Ga0451577_0002359_2305_3321
Length 338
Sequence MSLQAALLFLAAKQPSTFQEIASGCFARASPSQRHIKGNKMKQDILLVGTGALATLFAARLGEAGHSVHMLGTWKQGLQALRENGARILDADGNEHVYQVHATDDPNEVSGAKYAIVLVKSWQTERVARQLKLALADDGHALTLQNGLGNRETLSRDLGIGRVSLGVTTTGATLLGPGLVRTGGEGIISLEQNQALGPLEAALRSSNFNLQIVDDAQSLIWGKLVINAAINXXXXLLRVPNGELLTRPLARKMMASLASETAEVAAAEHVHLPFSNPVSAAEDVARRTAKNHSSMFQDVRRGAPTEIDAICGAITKRAELHGIKAPYNRTCWQLVRAL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
31 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
34 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
35 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
36 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
37 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
42 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
43 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
44 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
46 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
49 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
50 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
51 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
52 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
53 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
54 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
55 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
56 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
57 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
58 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
59 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
60 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
61 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
62 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
63 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
64 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1547630 2162886007 Bacteria 19385
2 MRS1b_contig_5883641 2162886011 Bacteria 1114
3 JGI25406J46586_10003377 3300003203 Bacteria 7516
4 Ga0065704_10000385 3300005289 Bacteria 41151
5 Ga0065707_10000437 3300005295 Bacteria 81012
6 Ga0065707_10002212 3300005295 Bacteria 6116
7 Ga0065707_10092931 3300005295 Bacteria 3697
8 Ga0070689_100026040 3300005340 Unclassified 4400
9 Ga0070705_100076544 3300005440 Bacteria 2041
10 Ga0070700_100178670 3300005441 Bacteria 1475
11 Ga0070706_100020027 3300005467 Bacteria 6166
12 Ga0070706_100126624 3300005467 Unclassified 2382
13 Ga0070707_100193240 3300005468 Bacteria 1985
14 Ga0070698_100022942 3300005471 Bacteria 6525
15 Ga0070699_100001164 3300005518 Bacteria 24377
16 Ga0070699_100010901 3300005518 Bacteria 7860
17 Ga0070697_100470765 3300005536 Bacteria 1096
18 Ga0068859_100065893 3300005617 Bacteria 3656
19 Ga0068859_100200752 3300005617 Unclassified 2079
20 Ga0068870_10089012 3300005840 Unclassified 1722
21 Ga0068870_10104393 3300005840 Unclassified 1608
22 Ga0068862_100036030 3300005844 Unclassified 4191
23 Ga0068862_100086713 3300005844 Unclassified 2722
24 Ga0081539_10001257 3300005985 Bacteria 44920
25 Ga0075430_100077438 3300006846 Bacteria 2787
26 Ga0075431_100103317 3300006847 Bacteria 2941
27 Ga0075431_100171367 3300006847 Bacteria 2230
28 Ga0075431_100280818 3300006847 Unclassified 1686
29 Ga0075433_10029294 3300006852 Unclassified 4689
30 Ga0075433_10074596 3300006852 Unclassified 2985
31 Ga0075433_10239956 3300006852 Bacteria 1609
32 Ga0075429_100000962 3300006880 Bacteria 22853
33 Ga0075429_100008156 3300006880 Bacteria 9106
34 Ga0075429_100019988 3300006880 Bacteria 5807
35 Ga0097620_100065895 3300006931 Bacteria 3656
36 Ga0097620_100200749 3300006931 Unclassified 2079
37 Ga0111539_10075724 3300009094 Unclassified 3963
38 Ga0114129_10001524 3300009147 Bacteria 31382
39 Ga0114129_10005370 3300009147 Bacteria 18085
40 Ga0114129_10017274 3300009147 Bacteria 10275
41 Ga0114129_10063873 3300009147 Bacteria 5138
42 Ga0114129_10088515 3300009147 Bacteria 4292
43 Ga0114129_10166984 3300009147 Bacteria 3003
44 Ga0105243_10065020 3300009148 Bacteria 2929
45 Ga0105249_10143417 3300009553 Bacteria 2292
46 Ga0207643_10120619 3300025908 Bacteria 1553
47 Ga0207670_10013019 3300025936 Unclassified 4891
48 Ga0268265_10048623 3300028380 Bacteria 3185
49 Ga0268265_10103874 3300028380 Unclassified 2302
50 Ga0268265_10500243 3300028380 Unclassified 1145
51 Ga0265334_10026819 3300028573 Unclassified 2323
52 Ga0265318_10006393 3300028577 Bacteria 5426
53 Ga0265338_10103644 3300028800 Unclassified 2310
54 Ga0265324_10030411 3300029957 Bacteria 1895
55 Ga0265328_10036492 3300031239 Bacteria 1816
56 Ga0265320_10022956 3300031240 Unclassified 3330
57 Ga0265340_10010799 3300031247 Unclassified 4877
58 Ga0265331_10032166 3300031250 Bacteria 2601
59 Ga0265316_10017140 3300031344 Bacteria 6269
60 Ga0316579_10001438 3300031691 Bacteria 8637
61 Ga0316579_10061560 3300031691 Bacteria 1767
62 Ga0316576_10004144 3300031727 Bacteria 8650
63 Ga0316576_10334199 3300031727 Unclassified 1129
64 Ga0316578_10003202 3300031728 Bacteria 7418
65 Ga0316578_10039919 3300031728 Bacteria 2712
66 Ga0316577_10003748 3300031733 Bacteria 7736
67 Ga0316577_10004172 3300031733 Bacteria 7420
68 Ga0316577_10013577 3300031733 Bacteria 4459
69 Ga0316577_10039905 3300031733 Bacteria 2626
70 Ga0316577_10199859 3300031733 Bacteria 1130
71 Ga0307407_10077539 3300031903 Unclassified 1999
72 Ga0316593_10008853 3300032168 Bacteria 2824
73 Ga0316574_0004416 3300035398 Bacteria 7365
74 Ga0316582_0009198 3300036647 Bacteria 5350
75 Ga0316582_0056405 3300036647 Bacteria 2506
76 Ga0316584_0006163 3300036712 Bacteria 8110
77 Ga0316584_0081064 3300036712 Bacteria 2430
78 Ga0316584_0114228 3300036712 Bacteria 2020
79 Ga0316584_0137825 3300036712 Bacteria 1821
80 Ga0316584_0252275 3300036712 Bacteria 1289
81 Ga0316581_0018080 3300037588 Unclassified 2043
82 Ga0451577_0002359 3300042876 Bacteria 22706
83 Ga0451577_0003479 3300042876 Bacteria 17512
84 Ga0451577_0097762 3300042876 Bacteria 2622
85 Ga0451577_0223630 3300042876 Unclassified 1701
86 Ga0451577_0594740 3300042876 Unclassified 1004
87 Ga0453683_0002142 3300044673 Bacteria 15736
88 Ga0453683_0006329 3300044673 Bacteria 8132
89 Ga0453683_0040475 3300044673 Bacteria 2926
90 Ga0453683_0062021 3300044673 Bacteria 2337
91 Ga0453683_0097646 3300044673 Bacteria 1844
92 Ga0453684_0000074 3300044712 Bacteria 438364
93 Ga0453684_0000232 3300044712 Bacteria 240951
94 Ga0453684_0000464 3300044712 Bacteria 161638
95 Ga0453684_0000541 3300044712 Bacteria 143452
96 Ga0453684_0002864 3300044712 Bacteria 40519
97 Ga0453684_0011188 3300044712 Bacteria 15105
98 Ga0453684_0044763 3300044712 Bacteria 5915
99 Ga0453684_0050241 3300044712 Bacteria 5489
100 Ga0453684_0050618 3300044712 Bacteria 5461
101 Ga0453684_0055695 3300044712 Bacteria 5139
102 Ga0453684_0057014 3300044712 Bacteria 5062
103 Ga0453684_0064502 3300044712 Bacteria 4678
104 Ga0453684_0087129 3300044712 Unclassified 3871
105 Ga0453684_0097221 3300044712 Unclassified 3614
106 Ga0453684_0106965 3300044712 Bacteria 3407
107 Ga0453684_0311619 3300044712 Unclassified 1785
108 Ga0453684_0316435 3300044712 Bacteria 1769
109 Ga0453684_0459984 3300044712 Bacteria 1415
110 Ga0453684_0494416 3300044712 Unclassified 1355
111 Ga0453684_0573331 3300044712 Bacteria 1240
112 Ga0453684_0639824 3300044712 Bacteria 1161
113 Ga0451576_0000258 3300045051 Bacteria 129651
114 Ga0451576_0006464 3300045051 Bacteria 14365
115 Ga0451576_0012017 3300045051 Bacteria 9777
116 Ga0451576_0020678 3300045051 Bacteria 7164
117 Ga0451576_0037940 3300045051 Bacteria 5101
118 Ga0451576_0049324 3300045051 Bacteria 4417
119 Ga0451576_0085168 3300045051 Bacteria 3288
120 Ga0451576_0352450 3300045051 Bacteria 1541
121 Ga0451576_0544278 3300045051 Unclassified 1220
122 Ga0451576_0586309 3300045051 Bacteria 1172
123 Ga0501072_0345553 3300049588 Unclassified 1181
124 Ga0501075_0047205 3300049591 Bacteria 3236
125 Ga0501076_0017238 3300049592 Bacteria 5485
126 Ga0501080_0065480 3300049742 Bacteria 3380
127 Ga0501081_0192756 3300049743 Bacteria 1476
128 nmdc:mga05p37_18727_c1 3300050507 Bacteria 8366
129 nmdc:mga05p37_2257_c1 3300050507 Bacteria 22446
130 nmdc:mga05p37_4771_c1 3300050507 Bacteria 14911
131 nmdc:mga05p37_7242_c1 3300050507 Bacteria 13087
132 nmdc:mga09592_220284_c1 3300050508 Bacteria 1644
133 nmdc:mga09592_28156_c2 3300050508 Bacteria 4008
134 nmdc:mga09592_346630_c1 3300050508 Unclassified 1286
135 nmdc:mga09592_50338_c1 3300050508 Unclassified 3514
136 nmdc:mga09592_52530_c1 3300050508 Bacteria 3440
137 nmdc:mga06r32_310904_c1 3300050510 Bacteria 1561
138 nmdc:mga06r32_791924_c1 3300050510 Bacteria 909
139 nmdc:mga0n895_130446_c1 3300050512 Bacteria 2538
140 nmdc:mga0a205_306353_c1 3300050515 Unclassified 1461
141 nmdc:mga0a205_43436_c1 3300050515 Bacteria 4333
142 Ga0501082_0082519 3300060353 Bacteria 2774
143 Ga0530510_0116613 3300061734 Bacteria 1958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028380 Ga0268265_10103874 Ga0268265_101038743 256
2 3300050510 nmdc:mga06r32_791924_c1 nmdc:mga06r32_791924_c1_87_899 270
3 3300006880 Ga0075429_100008156 Ga0075429_1000081563 271
4 3300044673 Ga0453683_0097646 Ga0453683_0097646_17_832 271
5 3300009148 Ga0105243_10065020 Ga0105243_100650204 274
6 3300045051 Ga0451576_0544278 Ga0451576_0544278_28_945 274
7 3300006852 Ga0075433_10029294 Ga0075433_100292945 277
8 3300036712 Ga0316584_0081064 Ga0316584_0081064_823_1698 277
9 3300050512 nmdc:mga0n895_130446_c1 nmdc:mga0n895_130446_c1_22_921 280
10 3300005617 Ga0068859_100200752 Ga0068859_1002007523 284
11 3300006931 Ga0097620_100200749 Ga0097620_1002007491 284
12 3300009147 Ga0114129_10005370 Ga0114129_100053706 284
13 3300050507 nmdc:mga05p37_4771_c1 nmdc:mga05p37_4771_c1_10500_11399 284
14 3300044712 Ga0453684_0011188 Ga0453684_0011188_1147_2049 286
15 3300045051 Ga0451576_0037940 Ga0451576_0037940_96_998 286
16 3300050508 nmdc:mga09592_220284_c1 nmdc:mga09592_220284_c1_222_1121 287
17 3300031733 Ga0316577_10003748 Ga0316577_100037486 288
18 3300032168 Ga0316593_10008853 Ga0316593_100088532 288
19 3300036647 Ga0316582_0009198 Ga0316582_0009198_907_1851 288
20 3300042876 Ga0451577_0097762 Ga0451577_0097762_1195_2106 288
21 3300042876 Ga0451577_0594740 Ga0451577_0594740_107_979 288
22 3300044712 Ga0453684_0000464 Ga0453684_0000464_111845_112756 288
23 3300045051 Ga0451576_0012017 Ga0451576_0012017_1458_2357 289
24 3300031727 Ga0316576_10004144 Ga0316576_100041442 297
25 3300031728 Ga0316578_10039919 Ga0316578_100399192 297
26 3300031733 Ga0316577_10039905 Ga0316577_100399052 297
27 3300042876 Ga0451577_0002359 Ga0451577_0002359_2305_3321 297
28 3300042876 Ga0451577_0003479 Ga0451577_0003479_10563_11462 297
29 3300044673 Ga0453683_0062021 Ga0453683_0062021_885_1808 297
30 3300044712 Ga0453684_0000232 Ga0453684_0000232_49788_50684 297
31 3300044712 Ga0453684_0000541 Ga0453684_0000541_76097_76996 297
32 3300044712 Ga0453684_0002864 Ga0453684_0002864_38446_39462 297
33 3300044712 Ga0453684_0055695 Ga0453684_0055695_3943_4839 297
34 3300044712 Ga0453684_0064502 Ga0453684_0064502_1795_2694 297
35 3300044712 Ga0453684_0639824 Ga0453684_0639824_136_1035 297
36 3300045051 Ga0451576_0085168 Ga0451576_0085168_2151_3074 297
37 3300003203 JGI25406J46586_10003377 JGI25406J46586_100033774 298
38 3300005518 Ga0070699_100010901 Ga0070699_1000109013 298
39 3300005536 Ga0070697_100470765 Ga0070697_1004707652 298
40 3300005844 Ga0068862_100086713 Ga0068862_1000867132 298
41 3300005985 Ga0081539_10001257 Ga0081539_1000125741 298
42 3300006847 Ga0075431_100103317 Ga0075431_1001033172 298
43 3300006847 Ga0075431_100171367 Ga0075431_1001713671 298
44 3300009147 Ga0114129_10088515 Ga0114129_100885152 298
45 3300009553 Ga0105249_10143417 Ga0105249_101434172 298
46 3300025908 Ga0207643_10120619 Ga0207643_101206191 298
47 3300028380 Ga0268265_10500243 Ga0268265_105002431 298
48 3300028573 Ga0265334_10026819 Ga0265334_100268193 298
49 3300028577 Ga0265318_10006393 Ga0265318_100063934 298
50 3300028800 Ga0265338_10103644 Ga0265338_101036441 298
51 3300029957 Ga0265324_10030411 Ga0265324_100304112 298
52 3300031239 Ga0265328_10036492 Ga0265328_100364922 298
53 3300031240 Ga0265320_10022956 Ga0265320_100229564 298
54 3300031247 Ga0265340_10010799 Ga0265340_100107995 298
55 3300031250 Ga0265331_10032166 Ga0265331_100321663 298
56 3300031344 Ga0265316_10017140 Ga0265316_100171402 298
57 3300031691 Ga0316579_10061560 Ga0316579_100615602 298
58 3300031903 Ga0307407_10077539 Ga0307407_100775393 298
59 3300036647 Ga0316582_0056405 Ga0316582_0056405_19_945 298
60 3300036712 Ga0316584_0252275 Ga0316584_0252275_317_1237 298
61 3300042876 Ga0451577_0223630 Ga0451577_0223630_21_917 298
62 3300044712 Ga0453684_0087129 Ga0453684_0087129_2287_3189 298
63 3300044712 Ga0453684_0106965 Ga0453684_0106965_2323_3243 298
64 3300044712 Ga0453684_0311619 Ga0453684_0311619_70_966 298
65 3300044712 Ga0453684_0316435 Ga0453684_0316435_205_1101 298
66 3300044712 Ga0453684_0494416 Ga0453684_0494416_31_957 298
67 2162886007 SwRhRL2b_contig_1547630 SwRhRL2b_0643.00004290 299
68 2162886011 MRS1b_contig_5883641 MRS1b_0189.00001960 299
69 3300005289 Ga0065704_10000385 Ga0065704_1000038529 299
70 3300005295 Ga0065707_10000437 Ga0065707_1000043761 299
71 3300005295 Ga0065707_10002212 Ga0065707_100022124 299
72 3300005295 Ga0065707_10092931 Ga0065707_100929312 299
73 3300005340 Ga0070689_100026040 Ga0070689_1000260403 299
74 3300005440 Ga0070705_100076544 Ga0070705_1000765442 299
75 3300005441 Ga0070700_100178670 Ga0070700_1001786701 299
76 3300005467 Ga0070706_100020027 Ga0070706_1000200277 299
77 3300005467 Ga0070706_100126624 Ga0070706_1001266243 299
78 3300005468 Ga0070707_100193240 Ga0070707_1001932402 299
79 3300005471 Ga0070698_100022942 Ga0070698_1000229423 299
80 3300005518 Ga0070699_100001164 Ga0070699_1000011648 299
81 3300005617 Ga0068859_100065893 Ga0068859_1000658933 299
82 3300005840 Ga0068870_10089012 Ga0068870_100890122 299
83 3300005840 Ga0068870_10104393 Ga0068870_101043932 299
84 3300005844 Ga0068862_100036030 Ga0068862_1000360303 299
85 3300006846 Ga0075430_100077438 Ga0075430_1000774382 299
86 3300006847 Ga0075431_100280818 Ga0075431_1002808182 299
87 3300006852 Ga0075433_10074596 Ga0075433_100745962 299
88 3300006852 Ga0075433_10239956 Ga0075433_102399562 299
89 3300006880 Ga0075429_100000962 Ga0075429_1000009621 299
90 3300006880 Ga0075429_100019988 Ga0075429_1000199884 299
91 3300006931 Ga0097620_100065895 Ga0097620_1000658952 299
92 3300009094 Ga0111539_10075724 Ga0111539_100757243 299
93 3300009147 Ga0114129_10001524 Ga0114129_100015245 299
94 3300009147 Ga0114129_10017274 Ga0114129_100172744 299
95 3300009147 Ga0114129_10063873 Ga0114129_100638735 299
96 3300009147 Ga0114129_10166984 Ga0114129_101669843 299
97 3300025936 Ga0207670_10013019 Ga0207670_100130193 299
98 3300028380 Ga0268265_10048623 Ga0268265_100486231 299
99 3300031691 Ga0316579_10001438 Ga0316579_100014385 299
100 3300031727 Ga0316576_10334199 Ga0316576_103341991 299
101 3300031728 Ga0316578_10003202 Ga0316578_100032026 299
102 3300031733 Ga0316577_10004172 Ga0316577_100041722 299
103 3300031733 Ga0316577_10013577 Ga0316577_100135772 299
104 3300031733 Ga0316577_10199859 Ga0316577_101998591 299
105 3300035398 Ga0316574_0004416 Ga0316574_0004416_2007_2948 299
106 3300036712 Ga0316584_0006163 Ga0316584_0006163_2752_3693 299
107 3300036712 Ga0316584_0114228 Ga0316584_0114228_864_1811 299
108 3300036712 Ga0316584_0137825 Ga0316584_0137825_418_1335 299
109 3300037588 Ga0316581_0018080 Ga0316581_0018080_405_1346 299
110 3300044673 Ga0453683_0002142 Ga0453683_0002142_12168_13124 299
111 3300044673 Ga0453683_0006329 Ga0453683_0006329_3476_4381 299
112 3300044673 Ga0453683_0040475 Ga0453683_0040475_1902_2807 299
113 3300044712 Ga0453684_0000074 Ga0453684_0000074_87379_88290 299
114 3300044712 Ga0453684_0044763 Ga0453684_0044763_917_1846 299
115 3300044712 Ga0453684_0050241 Ga0453684_0050241_3555_4484 299
116 3300044712 Ga0453684_0050618 Ga0453684_0050618_2820_3731 299
117 3300044712 Ga0453684_0057014 Ga0453684_0057014_3402_4340 299
118 3300044712 Ga0453684_0097221 Ga0453684_0097221_389_1297 299
119 3300044712 Ga0453684_0459984 Ga0453684_0459984_129_1136 299
120 3300044712 Ga0453684_0573331 Ga0453684_0573331_201_1112 299
121 3300045051 Ga0451576_0000258 Ga0451576_0000258_98616_99521 299
122 3300045051 Ga0451576_0006464 Ga0451576_0006464_1846_2745 299
123 3300045051 Ga0451576_0020678 Ga0451576_0020678_5126_6082 299
124 3300045051 Ga0451576_0049324 Ga0451576_0049324_2998_3897 299
125 3300045051 Ga0451576_0352450 Ga0451576_0352450_523_1479 299
126 3300045051 Ga0451576_0586309 Ga0451576_0586309_144_1052 299
127 3300049588 Ga0501072_0345553 Ga0501072_0345553_72_974 299
128 3300049591 Ga0501075_0047205 Ga0501075_0047205_1790_2692 299
129 3300049592 Ga0501076_0017238 Ga0501076_0017238_2563_3465 299
130 3300049742 Ga0501080_0065480 Ga0501080_0065480_2021_2923 299
131 3300049743 Ga0501081_0192756 Ga0501081_0192756_25_927 299
132 3300050507 nmdc:mga05p37_18727_c1 nmdc:mga05p37_18727_c1_3294_4217 299
133 3300050507 nmdc:mga05p37_2257_c1 nmdc:mga05p37_2257_c1_6221_7120 299
134 3300050507 nmdc:mga05p37_7242_c1 nmdc:mga05p37_7242_c1_7525_8424 299
135 3300050508 nmdc:mga09592_28156_c2 nmdc:mga09592_28156_c2_1896_2849 299
136 3300050508 nmdc:mga09592_346630_c1 nmdc:mga09592_346630_c1_141_1040 299
137 3300050508 nmdc:mga09592_50338_c1 nmdc:mga09592_50338_c1_2384_3307 299
138 3300050508 nmdc:mga09592_52530_c1 nmdc:mga09592_52530_c1_2502_3410 299
139 3300050510 nmdc:mga06r32_310904_c1 nmdc:mga06r32_310904_c1_177_1106 299
140 3300050515 nmdc:mga0a205_306353_c1 nmdc:mga0a205_306353_c1_68_970 299
141 3300050515 nmdc:mga0a205_43436_c1 nmdc:mga0a205_43436_c1_495_1394 299
142 3300060353 Ga0501082_0082519 Ga0501082_0082519_221_1123 299
143 3300061734 Ga0530510_0116613 Ga0530510_0116613_126_1028 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

45

194

0.98

PF08546

ApbA_C

Ketopantoate reductase PanE/ApbA C terminal

215

338

0.98

PF01210

NAD_Gly3P_dh_N

NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus

44

181

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0z-assembly1.cif.gz_C-2 crystal structure of alpk 1.002 4 31
6j38-assembly1.cif.gz_B-2 crystal structure of cmis2 0.9899 3 30
7vwp-assembly1.cif.gz_A structure of the flavin-dependent monooxygenase flso1 from the biosynthesis of fluostatinsin 0.988 4 31
1c0i-assembly1.cif.gz_A crystal structure of d-amino acid oxidase in complex with two anthranylate molecules 0.9874 2 31
4x4j-assembly1.cif.gz_B-2 structural and functional studies of bexe: insights into oxidation during be-7585a biosynthesis 0.987 4 30
ID Description Score Start End Superfamily
6j0zC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.002 4 31 3.50.50.60
af_P9WN19_146_269_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.002 4 30 3.50.50.60
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1 4 30 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9967 4 31 3.50.50.60
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9934 2 30 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3N5SJ83-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9885 4 298 GO:0005737
GO:0008677
GO:0015940
GO:0050661
AF-A0A7C1AJ35-F1-model_v4 2-dehydropantoate 2-reductase 0.9839 171 298 GO:0005737
GO:0008677
GO:0050661
AF-A0A524CTQ2-F1-model_v4 Ketopantoate reductase C-terminal domain-containing protein 0.9808 172 298 GO:0005737
GO:0008677
GO:0050661
AF-A0A059WLL5-F1-model_v4 Ketopantoate reductase PanE/ApbA C terminal 0.9739 183 298 GO:0005737
AF-A0A3N5SJ83-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9721 4 298 GO:0005737
GO:0008677
GO:0015940
GO:0050661

Feature Viewer

pLDDT pTM Quality
94.57 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map