F188447

General Info

Members Datasets Scaffolds Average Seq Length
143 81 122 382

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100109373|Ga0075431_1001093732
Length 411
Sequence VSVNENQTIPQVPSYGVGSFFRSLLSVLQQNIREYGMFIALFIIMAIFGIMTPNHAFISSRNISNLMNQTGYVAVLAVGMTLVIVIRHIDLSVGFLAGFIGAVAAIALVYWHWNIWLVLPFVLILGIIAGLLTAFPVAQLGIPAFVASLAGWLIYRGALLLATLKTGTIVIPDETFNAIGNGFVPDIPGLTILQGVHKLTLLIGLLAAIWYIYSAIDSRRKQKAYNFEVLHIIIFIMQLIFVSLLIAYITWVLAGYNGLSWTLVIVLVVVAIYDFITTRTVLGRHIYAVGGNPDAAELSGISVKKITYVVFGSMGMLSALSGILFASRLQSATTTAGTLFELDAIAAAYVGGVSAAGGVGKVTGSLIGALVMLSLTSGMNLMGIDISSQYIVRGAVLLLAVIFDVATRKGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
3 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
4 2738543017 Bacillus sp. OV186 Isolate Unclassified
5 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
6 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
7 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
8 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
9 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
10 2857472729 Cohnella sp. R-74144 Isolate Unclassified
11 2857586860 Bacillus sp. R-71935 Isolate Unclassified
12 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
13 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
14 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
15 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
16 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
17 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
18 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
43 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
44 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
55 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
56 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
61 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
69 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
70 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
71 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
72 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
73 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
74 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
75 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
76 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
77 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
78 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
79 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
80 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
81 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.62
Metatranscriptomes 0.7
Isolates 14.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0
Rhizoplane 1.4
Rhizosphere 79.02
Stem 0
Stem Tuber 0
Unclassified 11.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2531326 2162886007 Bacteria 4863
2 JGI25151J46595_10002081 3300003187 Bacteria 12469
3 JGI25151J46595_10009322 3300003187 Bacteria 4655
4 JGI25151J46595_10042700 3300003187 Bacteria 1630
5 Ga0055532_1000673 3300003758 Bacteria 12929
6 Ga0065704_10001175 3300005289 Bacteria 19085
7 Ga0065707_10000973 3300005295 Bacteria 11472
8 Ga0070688_100062115 3300005365 Bacteria 2364
9 Ga0070700_100165602 3300005441 Unclassified 1526
10 Ga0070685_10168723 3300005466 Bacteria 1401
11 Ga0070699_100019973 3300005518 Bacteria 5774
12 Ga0070699_100023198 3300005518 Bacteria 5347
13 Ga0068859_100137035 3300005617 Bacteria 2521
14 Ga0068862_100066657 3300005844 Bacteria 3103
15 Ga0068862_100286664 3300005844 Bacteria 1511
16 Ga0075428_100266206 3300006844 Bacteria 1845
17 Ga0075430_100017122 3300006846 Bacteria 6172
18 Ga0075431_100031472 3300006847 Bacteria 5465
19 Ga0075431_100109373 3300006847 Bacteria 2853
20 Ga0075429_100028709 3300006880 Bacteria 4831
21 Ga0075429_100134803 3300006880 Bacteria 2161
22 Ga0097620_100137030 3300006931 Bacteria 2521
23 Ga0114129_10001986 3300009147 Bacteria 27995
24 Ga0114129_10236195 3300009147 Bacteria 2459
25 Ga0105249_10095257 3300009553 Bacteria 2791
26 Ga0209566_100108 3300025225 Bacteria 119382
27 Ga0209147_100020 3300025229 Bacteria 474055
28 Ga0209676_1000493 3300025292 Bacteria 63491
29 Ga0209025_1000043 3300025294 Bacteria 350458
30 Ga0209025_1000997 3300025294 Bacteria 41992
31 Ga0209025_1003968 3300025294 Bacteria 13280
32 Ga0209025_1039327 3300025294 Bacteria 2064
33 Ga0207712_10045831 3300025961 Bacteria 3029
34 Ga0268265_10204684 3300028380 Bacteria 1715
35 Ga0265323_10025123 3300028653 Bacteria 2259
36 Ga0265322_10003240 3300028654 Bacteria 4939
37 Ga0265330_10001980 3300031235 Bacteria 11367
38 Ga0265320_10009062 3300031240 Bacteria 6034
39 Ga0265320_10098912 3300031240 Bacteria 1345
40 Ga0265329_10002424 3300031242 Bacteria 8453
41 Ga0265316_10007198 3300031344 Bacteria 10513
42 Ga0307508_10021705 3300031616 Bacteria 5840
43 Ga0316575_10029970 3300031665 Bacteria 2126
44 Ga0316575_10033418 3300031665 Bacteria 2017
45 Ga0316579_10000954 3300031691 Bacteria 10109
46 Ga0265342_10000280 3300031712 Bacteria 57399
47 Ga0316576_10028804 3300031727 Bacteria 3919
48 Ga0316576_10061429 3300031727 Bacteria 2754
49 Ga0316576_10159813 3300031727 Bacteria 1699
50 Ga0316578_10028485 3300031728 Bacteria 3163
51 Ga0316578_10049658 3300031728 Bacteria 2452
52 Ga0316577_10005246 3300031733 Bacteria 6781
53 Ga0316577_10014149 3300031733 Bacteria 4379
54 Ga0316577_10024024 3300031733 Bacteria 3386
55 Ga0316585_10009653 3300032137 Bacteria 2822
56 Ga0316593_10053071 3300032168 Bacteria 1373
57 Ga0316574_0001507 3300035398 Bacteria 11098
58 Ga0316574_0015392 3300035398 Unclassified 4437
59 Ga0316574_0176042 3300035398 Bacteria 1377
60 Ga0316582_0036646 3300036647 Bacteria 3036
61 Ga0316582_0052774 3300036647 Bacteria 2585
62 Ga0316582_0075163 3300036647 Bacteria 2195
63 Ga0316584_0000445 3300036712 Bacteria 21467
64 Ga0316584_0006516 3300036712 Bacteria 7907
65 Ga0316584_0007018 3300036712 Bacteria 7665
66 Ga0316584_0051581 3300036712 Bacteria 3076
67 Ga0316584_0064612 3300036712 Bacteria 2740
68 Ga0316584_0147330 3300036712 Bacteria 1754
69 Ga0316581_0018869 3300037588 Bacteria 2007
70 Ga0400483_130676 3300039062 Bacteria 1975
71 Ga0451577_0001168 3300042876 Bacteria 36979
72 Ga0453683_0000383 3300044673 Bacteria 52830
73 Ga0453683_0010136 3300044673 Bacteria 6257
74 Ga0453683_0026367 3300044673 Bacteria 3691
75 Ga0453683_0028507 3300044673 Bacteria 3535
76 Ga0453683_0032549 3300044673 Bacteria 3289
77 Ga0453683_0039322 3300044673 Bacteria 2973
78 Ga0453683_0153828 3300044673 Unclassified 1454
79 Ga0453683_0223273 3300044673 Bacteria 1198
80 Ga0466966_0043094 3300044684 Bacteria 2894
81 Ga0466963_0039099 3300044694 Bacteria 3106
82 Ga0453684_0000095 3300044712 Bacteria 378681
83 Ga0453684_0001339 3300044712 Bacteria 72274
84 Ga0453684_0002111 3300044712 Bacteria 50159
85 Ga0453684_0002220 3300044712 Bacteria 48195
86 Ga0453684_0005763 3300044712 Bacteria 24188
87 Ga0453684_0020961 3300044712 Bacteria 9804
88 Ga0453684_0022597 3300044712 Bacteria 9319
89 Ga0453684_0040924 3300044712 Bacteria 6281
90 Ga0453684_0050335 3300044712 Bacteria 5483
91 Ga0453684_0060779 3300044712 Bacteria 4855
92 Ga0453684_0074792 3300044712 Bacteria 4262
93 Ga0453684_0079023 3300044712 Bacteria 4113
94 Ga0453684_0088150 3300044712 Bacteria 3843
95 Ga0453684_0112049 3300044712 Bacteria 3313
96 Ga0453684_0127789 3300044712 Bacteria 3056
97 Ga0453684_0151343 3300044712 Bacteria 2757
98 Ga0453684_0186569 3300044712 Bacteria 2430
99 Ga0453684_0199738 3300044712 Bacteria 2332
100 Ga0453684_0231181 3300044712 Bacteria 2135
101 Ga0453684_0259038 3300044712 Bacteria 1993
102 Ga0453684_0295802 3300044712 Bacteria 1842
103 Ga0453684_0348713 3300044712 Bacteria 1670
104 Ga0451576_0000045 3300045051 Bacteria 334210
105 Ga0451576_0000482 3300045051 Bacteria 88682
106 Ga0451576_0007956 3300045051 Bacteria 12541
107 Ga0451576_0008418 3300045051 Bacteria 12109
108 Ga0451576_0047437 3300045051 Bacteria 4516
109 Ga0451576_0057206 3300045051 Bacteria 4076
110 Ga0451576_0230532 3300045051 Bacteria 1934
111 Ga0451576_0466729 3300045051 Bacteria 1326
112 Ga0496116_0038884 3300048919 Bacteria 3297
113 Ga0496121_0133642 3300048924 Bacteria 1852
114 Ga0496124_0088218 3300048927 Bacteria 2536
115 Ga0501071_0044752 3300049587 Bacteria 3176
116 Ga0501071_0120259 3300049587 Bacteria 1947
117 Ga0501072_0224399 3300049588 Bacteria 1497
118 Ga0501076_0067533 3300049592 Bacteria 2855
119 Ga0501081_0132868 3300049743 Bacteria 1779
120 nmdc:mga05p37_433319_c1 3300050507 Bacteria 1527
121 nmdc:mga09592_221190_c1 3300050508 Bacteria 1640
122 Ga0501084_0112191 3300054114 Bacteria 2291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0231181 Ga0453684_0231181_679_1863 335
2 3300044712 Ga0453684_0060779 Ga0453684_0060779_1281_2456 336
3 3300005441 Ga0070700_100165602 Ga0070700_1001656021 345
4 3300044712 Ga0453684_0151343 Ga0453684_0151343_431_1615 347
5 3300045051 Ga0451576_0008418 Ga0451576_0008418_9812_11029 351
6 3300050508 nmdc:mga09592_221190_c1 nmdc:mga09592_221190_c1_134_1261 352
7 iso_pu_bacteria 8002317523 8002318612 352
8 3300044694 Ga0466963_0039099 Ga0466963_0039099_875_2110 355
9 3300045051 Ga0451576_0230532 Ga0451576_0230532_203_1408 355
10 3300044673 Ga0453683_0000383 Ga0453683_0000383_44198_45379 357
11 3300045051 Ga0451576_0007956 Ga0451576_0007956_1122_2303 357
12 3300044684 Ga0466966_0043094 Ga0466966_0043094_76_1311 358
13 3300003187 JGI25151J46595_10009322 JGI25151J46595_100093221 361
14 3300003187 JGI25151J46595_10042700 JGI25151J46595_100427001 361
15 3300025292 Ga0209676_1000493 Ga0209676_10004936 361
16 3300025294 Ga0209025_1000997 Ga0209025_10009973 361
17 3300025294 Ga0209025_1003968 Ga0209025_10039681 361
18 3300044673 Ga0453683_0223273 Ga0453683_0223273_79_1188 361
19 3300031665 Ga0316575_10029970 Ga0316575_100299702 362
20 3300035398 Ga0316574_0015392 Ga0316574_0015392_1262_2455 362
21 3300003187 JGI25151J46595_10002081 JGI25151J46595_1000208112 367
22 3300025294 Ga0209025_1000043 Ga0209025_100004396 367
23 3300039062 Ga0400483_130676 Ga0400483_130676_819_1946 367
24 3300044673 Ga0453683_0153828 Ga0453683_0153828_341_1444 367
25 3300044712 Ga0453684_0088150 Ga0453684_0088150_1669_2826 367
26 3300044712 Ga0453684_0186569 Ga0453684_0186569_828_2018 367
27 3300049743 Ga0501081_0132868 Ga0501081_0132868_665_1768 367
28 3300044712 Ga0453684_0005763 Ga0453684_0005763_20140_21324 368
29 3300044712 Ga0453684_0022597 Ga0453684_0022597_7051_8235 368
30 3300044673 Ga0453683_0032549 Ga0453683_0032549_797_1978 370
31 3300006880 Ga0075429_100134803 Ga0075429_1001348032 371
32 3300031691 Ga0316579_10000954 Ga0316579_100009542 371
33 3300031727 Ga0316576_10061429 Ga0316576_100614293 371
34 3300031728 Ga0316578_10028485 Ga0316578_100284852 371
35 3300031733 Ga0316577_10005246 Ga0316577_100052466 371
36 3300032137 Ga0316585_10009653 Ga0316585_100096532 371
37 3300035398 Ga0316574_0001507 Ga0316574_0001507_1606_2793 371
38 3300036647 Ga0316582_0036646 Ga0316582_0036646_740_1927 371
39 3300036712 Ga0316584_0006516 Ga0316584_0006516_2193_3380 371
40 3300037588 Ga0316581_0018869 Ga0316581_0018869_777_1964 371
41 3300044712 Ga0453684_0259038 Ga0453684_0259038_64_1269 371
42 3300048919 Ga0496116_0038884 Ga0496116_0038884_64_1239 373
43 3300036647 Ga0316582_0052774 Ga0316582_0052774_1420_2547 375
44 3300036712 Ga0316584_0064612 Ga0316584_0064612_44_1171 375
45 3300036712 Ga0316584_0147330 Ga0316584_0147330_586_1713 375
46 3300042876 Ga0451577_0001168 Ga0451577_0001168_1882_3087 375
47 3300044712 Ga0453684_0002220 Ga0453684_0002220_21952_23157 375
48 3300050507 nmdc:mga05p37_433319_c1 nmdc:mga05p37_433319_c1_55_1182 375
49 3300025961 Ga0207712_10045831 Ga0207712_100458312 376
50 3300044712 Ga0453684_0199738 Ga0453684_0199738_774_1979 376
51 3300048924 Ga0496121_0133642 Ga0496121_0133642_280_1491 376
52 3300048927 Ga0496124_0088218 Ga0496124_0088218_172_1383 376
53 3300006846 Ga0075430_100017122 Ga0075430_1000171224 378
54 3300006880 Ga0075429_100028709 Ga0075429_1000287093 378
55 3300031616 Ga0307508_10021705 Ga0307508_100217054 378
56 3300044712 Ga0453684_0001339 Ga0453684_0001339_68222_69406 378
57 3300028653 Ga0265323_10025123 Ga0265323_100251231 379
58 3300028654 Ga0265322_10003240 Ga0265322_100032401 379
59 3300031235 Ga0265330_10001980 Ga0265330_100019807 379
60 3300031242 Ga0265329_10002424 Ga0265329_100024244 379
61 3300031344 Ga0265316_10007198 Ga0265316_100071984 379
62 3300031712 Ga0265342_10000280 Ga0265342_1000028010 379
63 3300044673 Ga0453683_0028507 Ga0453683_0028507_2309_3466 380
64 3300044712 Ga0453684_0000095 Ga0453684_0000095_301961_303148 380
65 3300044712 Ga0453684_0040924 Ga0453684_0040924_3525_4733 380
66 3300045051 Ga0451576_0000045 Ga0451576_0000045_124900_126057 380
67 3300044712 Ga0453684_0112049 Ga0453684_0112049_1841_3046 381
68 3300005365 Ga0070688_100062115 Ga0070688_1000621152 384
69 3300005466 Ga0070685_10168723 Ga0070685_101687231 384
70 3300035398 Ga0316574_0176042 Ga0316574_0176042_131_1318 384
71 3300044712 Ga0453684_0020961 Ga0453684_0020961_2286_3473 384
72 3300005844 Ga0068862_100286664 Ga0068862_1002866642 385
73 3300044712 Ga0453684_0348713 Ga0453684_0348713_91_1275 385
74 iso_pu_bacteria 2593339131 2595090203 386
75 iso_pu_bacteria 2757320391 2757567474 386
76 iso_pu_bacteria 2775507177 2777764152 386
77 iso_pu_bacteria 2775507192 2777837817 386
78 iso_pu_bacteria 2808606364 2808867585 386
79 3300044673 Ga0453683_0039322 Ga0453683_0039322_781_1968 387
80 iso_pu_bacteria 2600255286 2601638591 387
81 iso_pu_bacteria 2738543017 2739269272 387
82 iso_pu_bacteria 2857453340 2857453931 387
83 iso_pu_bacteria 2857472729 2857478124 387
84 iso_pu_bacteria 2857586860 2857589713 387
85 iso_pu_bacteria 2928510474 2928514739 387
86 iso_pu_bacteria 2936340661 2936343771 387
87 iso_pu_bacteria 2971410472 2971416976 387
88 iso_pu_bacteria 3001267043 3001270243 387
89 iso_pu_bacteria 3006969106 3006969791 387
90 iso_pu_bacteria 3006984091 3006986180 387
91 iso_pu_bacteria 3006988479 3006990332 387
92 iso_pu_bacteria 8046991243 8046994439 387
93 iso_pu_bacteria 8056533031 8056536625 387
94 iso_pu_bacteria 8057473075 8057477918 387
95 3300003758 Ga0055532_1000673 Ga0055532_10006731 390
96 3300025229 Ga0209147_100020 Ga0209147_100020135 390
97 3300025294 Ga0209025_1039327 Ga0209025_10393271 390
98 3300031240 Ga0265320_10009062 Ga0265320_100090624 390
99 3300025225 Ga0209566_100108 Ga0209566_10010836 391
100 3300031727 Ga0316576_10028804 Ga0316576_100288043 392
101 3300031728 Ga0316578_10049658 Ga0316578_100496581 392
102 3300031733 Ga0316577_10014149 Ga0316577_100141493 392
103 3300036712 Ga0316584_0007018 Ga0316584_0007018_1537_2715 392
104 3300049587 Ga0501071_0120259 Ga0501071_0120259_390_1568 392
105 3300049588 Ga0501072_0224399 Ga0501072_0224399_145_1323 392
106 3300049592 Ga0501076_0067533 Ga0501076_0067533_376_1554 392
107 3300006847 Ga0075431_100109373 Ga0075431_1001093732 393
108 3300031665 Ga0316575_10033418 Ga0316575_100334181 393
109 3300031733 Ga0316577_10024024 Ga0316577_100240242 393
110 3300032168 Ga0316593_10053071 Ga0316593_100530711 393
111 3300036647 Ga0316582_0075163 Ga0316582_0075163_468_1649 393
112 3300036712 Ga0316584_0000445 Ga0316584_0000445_5935_7116 393
113 3300036712 Ga0316584_0051581 Ga0316584_0051581_307_1488 393
114 3300044712 Ga0453684_0050335 Ga0453684_0050335_2847_4064 393
115 3300005518 Ga0070699_100019973 Ga0070699_1000199733 394
116 3300005518 Ga0070699_100023198 Ga0070699_1000231984 394
117 3300005617 Ga0068859_100137035 Ga0068859_1001370352 394
118 3300005844 Ga0068862_100066657 Ga0068862_1000666572 394
119 3300006844 Ga0075428_100266206 Ga0075428_1002662062 394
120 3300006847 Ga0075431_100031472 Ga0075431_1000314723 394
121 3300006931 Ga0097620_100137030 Ga0097620_1001370302 394
122 3300009147 Ga0114129_10001986 Ga0114129_1000198624 394
123 3300009147 Ga0114129_10236195 Ga0114129_102361953 394
124 3300009553 Ga0105249_10095257 Ga0105249_100952573 394
125 3300028380 Ga0268265_10204684 Ga0268265_102046842 394
126 3300031240 Ga0265320_10098912 Ga0265320_100989122 394
127 3300031727 Ga0316576_10159813 Ga0316576_101598132 394
128 3300044673 Ga0453683_0010136 Ga0453683_0010136_3416_4624 394
129 3300044673 Ga0453683_0026367 Ga0453683_0026367_1556_2740 394
130 3300044712 Ga0453684_0002111 Ga0453684_0002111_17164_18348 394
131 3300044712 Ga0453684_0074792 Ga0453684_0074792_1733_2917 394
132 3300044712 Ga0453684_0079023 Ga0453684_0079023_2281_3486 394
133 3300044712 Ga0453684_0295802 Ga0453684_0295802_463_1647 394
134 3300045051 Ga0451576_0047437 Ga0451576_0047437_1147_2331 394
135 3300045051 Ga0451576_0057206 Ga0451576_0057206_2561_3769 394
136 3300045051 Ga0451576_0466729 Ga0451576_0466729_123_1313 394
137 3300049587 Ga0501071_0044752 Ga0501071_0044752_420_1652 394
138 3300054114 Ga0501084_0112191 Ga0501084_0112191_318_1550 394
139 3300045051 Ga0451576_0000482 Ga0451576_0000482_18600_19793 395
140 2162886007 SwRhRL2b_contig_2531326 SwRhRL2b_0473.00004850 396
141 3300005289 Ga0065704_10001175 Ga0065704_1000117510 396
142 3300005295 Ga0065707_10000973 Ga0065707_100009737 396
143 3300044712 Ga0453684_0127789 Ga0453684_0127789_411_1601 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

62

401

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5268 47 391
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4844 47 391
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.3475 17 320
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.3286 17 320
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.3282 1 313
ID Description Score Start End Superfamily
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9617 45 385 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9547 45 385 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9505 44 385 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9492 44 385 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9471 44 385 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A3M1FRL4-F1-model_v4 Ribose ABC transporter permease 0.982 16 386 GO:0005886
GO:0022857
AF-A0A1V5KEQ5-F1-model_v4 Ribose transport system permease protein RbsC 0.9759 15 390 GO:0005886
GO:0022857
AF-A0A2N7PV35-F1-model_v4 deleted 0.9734 15 388
AF-K9EVY5-F1-model_v4 Xylose transport system permease protein XylH 0.9726 14 394 GO:0005886
GO:0022857
AF-A0A537LF05-F1-model_v4 ABC transporter permease 0.9725 18 394 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
81.04 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map