F185252

General Info

Members Datasets Scaffolds Average Seq Length
142 112 142 160

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10189987|Ga0081455_101899871
Length 194
Sequence LNSDVGLPTLPAKKQRGHCLRSDRRLRNGPPRRGATALLYFILKFLHIIGASVLLGTGAGIAFFMLAAHLGGKPEVIAGVVRIVVIADFIFTATAVVVQPITGVLLAWTVGYPLSEGWIMLSIILYFVTGAFWLPVVWMQMRMRDLAIKAVASGEPLPRAYHTLFWWWFAFGFPAFAAVMAIFWLMIMRPQLTF

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
33 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
34 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
35 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
36 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
47 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
48 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
49 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
68 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
69 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
85 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
106 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
111 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 5.63
Rhizoplane 9.15
Rhizosphere 79.58
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100130344 3300005336 Bacteria 2104
2 Ga0070709_10703850 3300005434 Bacteria 786
3 Ga0070714_100610780 3300005435 Unclassified 1048
4 Ga0070713_100039701 3300005436 Bacteria 3822
5 Ga0070701_10863992 3300005438 Bacteria 622
6 Ga0070700_100452487 3300005441 Bacteria 977
7 Ga0070681_10315587 3300005458 Bacteria 1472
8 Ga0070681_11400603 3300005458 Bacteria 623
9 Ga0070679_100460316 3300005530 Bacteria 1217
10 Ga0070696_100285288 3300005546 Bacteria 1260
11 Ga0068863_101230560 3300005841 Bacteria 755
12 Ga0081455_10189987 3300005937 Bacteria 1547
13 Ga0081540_1002398 3300005983 Bacteria 15288
14 Ga0081539_10030659 3300005985 Bacteria 3332
15 Ga0070717_10058639 3300006028 Bacteria 3183
16 Ga0070717_10227342 3300006028 Bacteria 1642
17 Ga0075362_10087981 3300006177 Bacteria 1439
18 Ga0075367_10026424 3300006178 Bacteria 3293
19 Ga0075430_100740685 3300006846 Bacteria 810
20 Ga0099823_1039809 3300006944 Bacteria 3432
21 Ga0111539_10055231 3300009094 Bacteria 4721
22 Ga0105247_11025017 3300009101 Bacteria 646
23 Ga0114129_10239601 3300009147 Bacteria 2439
24 Ga0114129_10244155 3300009147 Bacteria 2413
25 Ga0105249_10701604 3300009553 Unclassified 1072
26 Ga0105249_12154099 3300009553 Bacteria 630
27 Ga0099796_10029888 3300010159 Bacteria 1762
28 Ga0105239_11728511 3300010375 Bacteria 724
29 Ga0105246_10498787 3300011119 Bacteria 1033
30 Ga0157371_10269280 3300013102 Bacteria 1229
31 Ga0157370_10135325 3300013104 Bacteria 2297
32 Ga0163162_11049875 3300013306 Bacteria 922
33 Ga0157372_11183174 3300013307 Bacteria 884
34 Ga0163163_10550217 3300014325 Bacteria 1217
35 Ga0157380_10177322 3300014326 Unclassified 1869
36 Ga0214544_1000005 3300021320 Bacteria 387675
37 Ga0214542_1000004 3300021321 Bacteria 415597
38 Ga0214545_1000005 3300021324 Bacteria 415590
39 Ga0214543_1004565 3300021327 Bacteria 26116
40 Ga0207642_10488750 3300025899 Bacteria 752
41 Ga0207652_10841313 3300025921 Bacteria 813
42 Ga0207700_10287106 3300025928 Bacteria 1417
43 Ga0207664_10104152 3300025929 Bacteria 2349
44 Ga0207664_10389363 3300025929 Bacteria 1238
45 Ga0207669_10815089 3300025937 Bacteria 775
46 Ga0207679_11014600 3300025945 Bacteria 761
47 Ga0207712_10544154 3300025961 Bacteria 998
48 Ga0207703_11562790 3300026035 Bacteria 635
49 Ga0207708_10524946 3300026075 Bacteria 995
50 Ga0207641_10409125 3300026088 Bacteria 1304
51 Ga0207641_11113871 3300026088 Bacteria 788
52 Ga0209389_1000021 3300027296 Bacteria 169506
53 Ga0209489_110360 3300027361 Bacteria 10587
54 Ga0209700_100483 3300027363 Bacteria 74857
55 Ga0209970_1066180 3300027614 Bacteria 668
56 Ga0307405_10000204 3300031731 Bacteria 21623
57 Ga0307405_10055834 3300031731 Bacteria 2474
58 Ga0307413_10645887 3300031824 Bacteria 872
59 Ga0307410_10377973 3300031852 Bacteria 1139
60 Ga0307410_10611518 3300031852 Bacteria 910
61 Ga0307406_10095059 3300031901 Bacteria 2016
62 Ga0307407_10282133 3300031903 Bacteria 1151
63 Ga0307407_10820767 3300031903 Bacteria 709
64 Ga0307412_10063921 3300031911 Bacteria 2485
65 Ga0307412_10427467 3300031911 Bacteria 1085
66 Ga0307409_100183954 3300031995 Bacteria 1853
67 Ga0307409_100579603 3300031995 Bacteria 1106
68 Ga0307416_100203509 3300032002 Bacteria 1881
69 Ga0307416_102828745 3300032002 Bacteria 580
70 Ga0307414_10229447 3300032004 Bacteria 1530
71 Ga0307411_10390740 3300032005 Bacteria 1147
72 Ga0307411_10914869 3300032005 Bacteria 780
73 Ga0307415_100064595 3300032126 Bacteria 2547
74 Ga0307415_100287714 3300032126 Bacteria 1355
75 Ga0373946_0112046 3300035171 Bacteria 1236
76 Ga0373931_1028143 3300035691 Unclassified 558
77 Ga0373947_0495056 3300035725 Bacteria 830
78 Ga0395899_0825402 3300037312 Bacteria 571
79 Ga0395905_0372052 3300037471 Bacteria 1322
80 Ga0436365_0494383 3300039437 Bacteria 818
81 Ga0436365_1850812 3300039437 Bacteria 719
82 Ga0436360_0674265 3300039438 Bacteria 1142
83 Ga0436360_0977421 3300039438 Bacteria 1041
84 Ga0450895_015003 3300042132 Bacteria 688
85 Ga0450910_079976 3300042147 Bacteria 570
86 Ga0466972_0039404 3300044658 Bacteria 2306
87 Ga0466972_0129464 3300044658 Bacteria 1188
88 Ga0466965_0395432 3300044683 Bacteria 763
89 Ga0466966_0018177 3300044684 Bacteria 4639
90 Ga0466961_0077863 3300044693 Bacteria 2100
91 Ga0466964_0130116 3300044706 Bacteria 1145
92 Ga0466971_0033862 3300044719 Bacteria 2289
93 Ga0466968_0045953 3300044735 Bacteria 1854
94 Ga0466970_0513686 3300044765 Bacteria 690
95 Ga0466957_0027962 3300044842 Bacteria 3354
96 Ga0466957_0173773 3300044842 Bacteria 1404
97 Ga0466960_0211907 3300044901 Bacteria 1062
98 Ga0466959_0044398 3300045049 Bacteria 3275
99 Ga0466959_0422364 3300045049 Bacteria 905
100 Ga0466958_0023559 3300045836 Bacteria 3615
101 Ga0466967_0341269 3300045976 Bacteria 1449
102 Ga0495631_0242880 3300046518 Bacteria 768
103 Ga0495668_0456847 3300046616 Bacteria 703
104 Ga0495660_0241939 3300046810 Bacteria 841
105 Ga0496104_0000660 3300048907 Bacteria 29613
106 Ga0496104_0001794 3300048907 Bacteria 18599
107 Ga0496105_0016217 3300048908 Bacteria 5944
108 Ga0496105_0223191 3300048908 Bacteria 1534
109 Ga0496106_0288671 3300048909 Bacteria 1315
110 Ga0496108_0023403 3300048911 Bacteria 5084
111 Ga0496108_0223047 3300048911 Bacteria 1638
112 Ga0496109_0077078 3300048912 Bacteria 3067
113 Ga0496110_0403189 3300048913 Bacteria 1247
114 Ga0496112_0220716 3300048915 Bacteria 1852
115 Ga0496112_0303033 3300048915 Unclassified 1543
116 Ga0496113_0158720 3300048916 Unclassified 1787
117 Ga0496115_0251305 3300048918 Bacteria 1455
118 Ga0501034_0726147 3300049571 Bacteria 890
119 Ga0501040_0187347 3300049576 Bacteria 1468
120 Ga0501046_0453408 3300049580 Bacteria 922
121 Ga0501048_0349249 3300049582 Bacteria 1055
122 Ga0501048_0775276 3300049582 Bacteria 689
123 Ga0501071_0193454 3300049587 Bacteria 1526
124 Ga0501072_0242297 3300049588 Bacteria 1436
125 Ga0501074_0278693 3300049590 Bacteria 1189
126 Ga0501080_0163490 3300049742 Bacteria 2055
127 Ga0501080_0383608 3300049742 Bacteria 1266
128 Ga0501080_0985546 3300049742 Bacteria 732
129 Ga0501270_122045 3300049767 Bacteria 568
130 Ga0501045_0433708 3300049824 Bacteria 977
131 nmdc:mga06z11_20283_c1 3300050494 Bacteria 3071
132 nmdc:mga04h51_183864_c1 3300050495 Bacteria 815
133 nmdc:mga09592_201260_c1 3300050508 Bacteria 1725
134 nmdc:mga09592_96659_c1 3300050508 Bacteria 2527
135 nmdc:mga0qj67_29060_c1 3300050509 Bacteria 4293
136 nmdc:mga06r32_124444_c1 3300050510 Bacteria 2546
137 nmdc:mga06r32_131550_c1 3300050510 Bacteria 2474
138 nmdc:mga06r32_69378_c1 3300050510 Bacteria 3407
139 Ga0500556_0001384 3300053104 Bacteria 10596
140 Ga0500627_0200881 3300053158 Bacteria 893
141 Ga0466962_0055149 3300061719 Bacteria 1899
142 Ga0466962_0124582 3300061719 Bacteria 1244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100130344 Ga0070680_1001303443 155
2 3300005434 Ga0070709_10703850 Ga0070709_107038502 155
3 3300005435 Ga0070714_100610780 Ga0070714_1006107802 155
4 3300005436 Ga0070713_100039701 Ga0070713_1000397012 155
5 3300005438 Ga0070701_10863992 Ga0070701_108639921 155
6 3300005441 Ga0070700_100452487 Ga0070700_1004524872 155
7 3300005458 Ga0070681_10315587 Ga0070681_103155872 155
8 3300005458 Ga0070681_11400603 Ga0070681_114006031 155
9 3300005530 Ga0070679_100460316 Ga0070679_1004603162 155
10 3300005546 Ga0070696_100285288 Ga0070696_1002852882 155
11 3300005841 Ga0068863_101230560 Ga0068863_1012305601 155
12 3300005937 Ga0081455_10189987 Ga0081455_101899871 155
13 3300005983 Ga0081540_1002398 Ga0081540_100239815 155
14 3300005985 Ga0081539_10030659 Ga0081539_100306595 155
15 3300006028 Ga0070717_10058639 Ga0070717_100586392 155
16 3300006028 Ga0070717_10227342 Ga0070717_102273423 155
17 3300006177 Ga0075362_10087981 Ga0075362_100879811 155
18 3300006178 Ga0075367_10026424 Ga0075367_100264242 155
19 3300006846 Ga0075430_100740685 Ga0075430_1007406852 155
20 3300006944 Ga0099823_1039809 Ga0099823_10398093 155
21 3300009094 Ga0111539_10055231 Ga0111539_100552312 155
22 3300009101 Ga0105247_11025017 Ga0105247_110250172 155
23 3300009147 Ga0114129_10239601 Ga0114129_102396012 155
24 3300009147 Ga0114129_10244155 Ga0114129_102441552 155
25 3300009553 Ga0105249_10701604 Ga0105249_107016042 155
26 3300009553 Ga0105249_12154099 Ga0105249_121540992 155
27 3300010159 Ga0099796_10029888 Ga0099796_100298882 155
28 3300010375 Ga0105239_11728511 Ga0105239_117285112 155
29 3300011119 Ga0105246_10498787 Ga0105246_104987872 155
30 3300013102 Ga0157371_10269280 Ga0157371_102692802 155
31 3300013104 Ga0157370_10135325 Ga0157370_101353253 155
32 3300013306 Ga0163162_11049875 Ga0163162_110498752 155
33 3300013307 Ga0157372_11183174 Ga0157372_111831742 155
34 3300014325 Ga0163163_10550217 Ga0163163_105502172 155
35 3300014326 Ga0157380_10177322 Ga0157380_101773222 155
36 3300021320 Ga0214544_1000005 Ga0214544_1000005183 155
37 3300021321 Ga0214542_1000004 Ga0214542_1000004187 155
38 3300021324 Ga0214545_1000005 Ga0214545_1000005210 155
39 3300021327 Ga0214543_1004565 Ga0214543_10045655 155
40 3300025899 Ga0207642_10488750 Ga0207642_104887502 155
41 3300025921 Ga0207652_10841313 Ga0207652_108413132 155
42 3300025928 Ga0207700_10287106 Ga0207700_102871062 155
43 3300025929 Ga0207664_10104152 Ga0207664_101041522 155
44 3300025929 Ga0207664_10389363 Ga0207664_103893631 155
45 3300025937 Ga0207669_10815089 Ga0207669_108150891 155
46 3300025945 Ga0207679_11014600 Ga0207679_110146001 155
47 3300025961 Ga0207712_10544154 Ga0207712_105441542 155
48 3300026035 Ga0207703_11562790 Ga0207703_115627902 155
49 3300026075 Ga0207708_10524946 Ga0207708_105249462 155
50 3300026088 Ga0207641_10409125 Ga0207641_104091251 155
51 3300026088 Ga0207641_11113871 Ga0207641_111138712 155
52 3300027296 Ga0209389_1000021 Ga0209389_10000215 155
53 3300027361 Ga0209489_110360 Ga0209489_1103606 155
54 3300027363 Ga0209700_100483 Ga0209700_10048335 155
55 3300027614 Ga0209970_1066180 Ga0209970_10661802 155
56 3300031731 Ga0307405_10000204 Ga0307405_1000020418 155
57 3300031731 Ga0307405_10055834 Ga0307405_100558342 155
58 3300031824 Ga0307413_10645887 Ga0307413_106458872 155
59 3300031852 Ga0307410_10377973 Ga0307410_103779732 155
60 3300031852 Ga0307410_10611518 Ga0307410_106115182 155
61 3300031901 Ga0307406_10095059 Ga0307406_100950592 155
62 3300031903 Ga0307407_10282133 Ga0307407_102821332 155
63 3300031903 Ga0307407_10820767 Ga0307407_108207672 155
64 3300031911 Ga0307412_10063921 Ga0307412_100639213 155
65 3300031911 Ga0307412_10427467 Ga0307412_104274672 155
66 3300031995 Ga0307409_100183954 Ga0307409_1001839542 155
67 3300031995 Ga0307409_100579603 Ga0307409_1005796032 155
68 3300032002 Ga0307416_100203509 Ga0307416_1002035092 155
69 3300032002 Ga0307416_102828745 Ga0307416_1028287452 155
70 3300032004 Ga0307414_10229447 Ga0307414_102294473 155
71 3300032005 Ga0307411_10390740 Ga0307411_103907402 155
72 3300032005 Ga0307411_10914869 Ga0307411_109148692 155
73 3300032126 Ga0307415_100064595 Ga0307415_1000645953 155
74 3300032126 Ga0307415_100287714 Ga0307415_1002877142 155
75 3300035171 Ga0373946_0112046 Ga0373946_0112046_729_1214 155
76 3300035691 Ga0373931_1028143 Ga0373931_1028143_38_511 155
77 3300035725 Ga0373947_0495056 Ga0373947_0495056_75_560 155
78 3300037312 Ga0395899_0825402 Ga0395899_0825402_86_559 155
79 3300037471 Ga0395905_0372052 Ga0395905_0372052_381_863 155
80 3300039437 Ga0436365_0494383 Ga0436365_0494383_177_656 155
81 3300039437 Ga0436365_1850812 Ga0436365_1850812_30_512 155
82 3300039438 Ga0436360_0674265 Ga0436360_0674265_81_554 155
83 3300039438 Ga0436360_0977421 Ga0436360_0977421_75_554 155
84 3300042132 Ga0450895_015003 Ga0450895_015003_51_539 155
85 3300042147 Ga0450910_079976 Ga0450910_079976_23_505 155
86 3300044658 Ga0466972_0039404 Ga0466972_0039404_567_1046 155
87 3300044658 Ga0466972_0129464 Ga0466972_0129464_226_705 155
88 3300044683 Ga0466965_0395432 Ga0466965_0395432_165_644 155
89 3300044684 Ga0466966_0018177 Ga0466966_0018177_2177_2665 155
90 3300044693 Ga0466961_0077863 Ga0466961_0077863_538_1026 155
91 3300044706 Ga0466964_0130116 Ga0466964_0130116_59_547 155
92 3300044719 Ga0466971_0033862 Ga0466971_0033862_1075_1563 155
93 3300044735 Ga0466968_0045953 Ga0466968_0045953_299_778 155
94 3300044765 Ga0466970_0513686 Ga0466970_0513686_167_652 155
95 3300044842 Ga0466957_0027962 Ga0466957_0027962_2423_2911 155
96 3300044842 Ga0466957_0173773 Ga0466957_0173773_124_642 155
97 3300044901 Ga0466960_0211907 Ga0466960_0211907_529_1008 155
98 3300045049 Ga0466959_0044398 Ga0466959_0044398_1159_1677 155
99 3300045049 Ga0466959_0422364 Ga0466959_0422364_205_684 155
100 3300045836 Ga0466958_0023559 Ga0466958_0023559_626_1114 155
101 3300045976 Ga0466967_0341269 Ga0466967_0341269_717_1205 155
102 3300046518 Ga0495631_0242880 Ga0495631_0242880_230_709 155
103 3300046616 Ga0495668_0456847 Ga0495668_0456847_181_660 155
104 3300046810 Ga0495660_0241939 Ga0495660_0241939_22_501 155
105 3300048907 Ga0496104_0000660 Ga0496104_0000660_20464_20961 155
106 3300048907 Ga0496104_0001794 Ga0496104_0001794_6598_7074 155
107 3300048908 Ga0496105_0016217 Ga0496105_0016217_827_1303 155
108 3300048908 Ga0496105_0223191 Ga0496105_0223191_858_1355 155
109 3300048909 Ga0496106_0288671 Ga0496106_0288671_756_1253 155
110 3300048911 Ga0496108_0023403 Ga0496108_0023403_74_550 155
111 3300048911 Ga0496108_0223047 Ga0496108_0223047_494_991 155
112 3300048912 Ga0496109_0077078 Ga0496109_0077078_682_1179 155
113 3300048913 Ga0496110_0403189 Ga0496110_0403189_508_981 155
114 3300048915 Ga0496112_0220716 Ga0496112_0220716_1134_1631 155
115 3300048915 Ga0496112_0303033 Ga0496112_0303033_652_1128 155
116 3300048916 Ga0496113_0158720 Ga0496113_0158720_175_651 155
117 3300048918 Ga0496115_0251305 Ga0496115_0251305_642_1139 155
118 3300049571 Ga0501034_0726147 Ga0501034_0726147_13_489 155
119 3300049576 Ga0501040_0187347 Ga0501040_0187347_699_1181 155
120 3300049580 Ga0501046_0453408 Ga0501046_0453408_360_833 155
121 3300049582 Ga0501048_0349249 Ga0501048_0349249_459_941 155
122 3300049582 Ga0501048_0775276 Ga0501048_0775276_40_516 155
123 3300049587 Ga0501071_0193454 Ga0501071_0193454_22_504 155
124 3300049588 Ga0501072_0242297 Ga0501072_0242297_705_1190 155
125 3300049590 Ga0501074_0278693 Ga0501074_0278693_294_776 155
126 3300049742 Ga0501080_0163490 Ga0501080_0163490_827_1312 155
127 3300049742 Ga0501080_0383608 Ga0501080_0383608_274_765 155
128 3300049742 Ga0501080_0985546 Ga0501080_0985546_122_592 155
129 3300049767 Ga0501270_122045 Ga0501270_122045_19_492 155
130 3300049824 Ga0501045_0433708 Ga0501045_0433708_143_625 155
131 3300050494 nmdc:mga06z11_20283_c1 nmdc:mga06z11_20283_c1_1644_2123 155
132 3300050495 nmdc:mga04h51_183864_c1 nmdc:mga04h51_183864_c1_179_658 155
133 3300050508 nmdc:mga09592_201260_c1 nmdc:mga09592_201260_c1_533_1006 155
134 3300050508 nmdc:mga09592_96659_c1 nmdc:mga09592_96659_c1_1453_1926 155
135 3300050509 nmdc:mga0qj67_29060_c1 nmdc:mga0qj67_29060_c1_1085_1558 155
136 3300050510 nmdc:mga06r32_124444_c1 nmdc:mga06r32_124444_c1_599_1072 155
137 3300050510 nmdc:mga06r32_131550_c1 nmdc:mga06r32_131550_c1_1207_1680 155
138 3300050510 nmdc:mga06r32_69378_c1 nmdc:mga06r32_69378_c1_2109_2582 155
139 3300053104 Ga0500556_0001384 Ga0500556_0001384_2685_3164 155
140 3300053158 Ga0500627_0200881 Ga0500627_0200881_129_608 155
141 3300061719 Ga0466962_0055149 Ga0466962_0055149_883_1371 155
142 3300061719 Ga0466962_0124582 Ga0466962_0124582_163_681 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

41

190

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dh6-assembly1.cif.gz_c cryo-em structure of saccharomyces cerevisiae cytochrome c oxidase (complex iv) extracted in lipid nanodiscs 0.6827 11 148
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.6705 9 153
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.6504 4 155
4qim-assembly1.cif.gz_A structure of the human smoothened receptor in complex with anta xv 0.6453 4 142
7jrp-assembly1.cif.gz_c plant mitochondrial complex sc iii2+iv from vigna radiata 0.6422 9 147
ID Description Score Start End Superfamily
af_F4JXP4_437_551_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7844 77 150 1.20.140.150
af_P0DP42_16_168_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7556 88 152 1.20.140.150
af_P26039_1846_1970_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7365 10 146 3.10.20.90
2yfbB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.7335 13 150 1.20.1440.210
2yfaB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.723 13 150 1.20.1440.210
ID Description Score Start End GO Terms
AF-A0A4Q3QCN3-F1-model_v4 deleted 0.9778 74 155
AF-A0A0Q7PJL4-F1-model_v4 DUF2269 domain-containing protein 0.9758 3 155 GO:0016020
AF-A0A2T6N1W8-F1-model_v4 DUF2269 domain-containing protein 0.9703 3 155 GO:0016020
AF-A0A6M7XXB4-F1-model_v4 DUF2269 domain-containing protein 0.9697 1 155 GO:0016020
AF-A0A4Q5PVK4-F1-model_v4 DUF2269 domain-containing protein 0.9687 3 153 GO:0016020

Feature Viewer

pLDDT pTM Quality
95.53 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map