F184426

General Info

Members Datasets Scaffolds Average Seq Length
142 97 284 153

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10079526|rootH2_100795263
Length 176
Sequence LSSRGNPSYLSFDVISNIDTSDTLILPPRYYFDTSVFGGVFDCEFEYETRILFNRVEAGEIKCVYSALAETELKSAPERVRRFFQDLSAETLERIEVNEAVVTLARKYIEDDVVGLTSLDDCVHIALATFHEVDMLISWNFKHIVNQARIPGYNSVNLQLGYKAIEIRSPKGIMNS

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
82 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
85 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
86 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
87 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
95 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
96 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
97 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 0
Rhizosphere 93.66
Stem 0
Stem Tuber 0
Unclassified 19.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10079526 3300003320 Unclassified 1358
2 JGI24739J22299_10035008 3300001989 Bacteria 1705
3 JGI25406J46586_10064239 3300003203 Eukaryota 1173
4 JGI25406J46586_10218879 3300003203 Bacteria 557
5 rootL2_10280160 3300003322 Bacteria 1707
6 rootL2_10352417 3300003322 Bacteria 1201
7 Ga0065712_10554551 3300005290 Unclassified 615
8 Ga0065715_10499526 3300005293 Unclassified 781
9 Ga0070666_10043301 3300005335 Bacteria 3014
10 Ga0070680_100544587 3300005336 Bacteria 994
11 Ga0070708_100982894 3300005445 Bacteria 792
12 Ga0070699_100216026 3300005518 Unclassified 1708
13 Ga0068853_100117673 3300005539 Bacteria 2367
14 Ga0068853_100505557 3300005539 Bacteria 1141
15 Ga0070686_100167587 3300005544 Bacteria 1551
16 Ga0070696_100006445 3300005546 Bacteria 7848
17 Ga0070693_100522452 3300005547 Bacteria 845
18 Ga0068854_100492134 3300005578 Bacteria 1031
19 Ga0068856_101562271 3300005614 Unclassified 673
20 Ga0068859_100712590 3300005617 Bacteria 1094
21 Ga0068863_100528907 3300005841 Bacteria 1163
22 Ga0068862_100000918 3300005844 Bacteria 28558
23 Ga0081455_10415236 3300005937 Bacteria 930
24 Ga0081539_10028486 3300005985 Bacteria 3512
25 Ga0081539_10049194 3300005985 Bacteria 2394
26 Ga0081539_10345590 3300005985 Bacteria 626
27 Ga0075428_100265548 3300006844 Bacteria 1847
28 Ga0075428_101922993 3300006844 Unclassified 614
29 Ga0075430_100565732 3300006846 Unclassified 938
30 Ga0075431_100219691 3300006847 Bacteria 1939
31 Ga0075431_100240164 3300006847 Bacteria 1843
32 Ga0075433_10679957 3300006852 Bacteria 902
33 Ga0075434_100053712 3300006871 Bacteria 4003
34 Ga0075434_100745063 3300006871 Bacteria 997
35 Ga0075429_100025528 3300006880 Bacteria 5128
36 Ga0075429_100315167 3300006880 Bacteria 1369
37 Ga0075436_100092727 3300006914 Bacteria 2100
38 Ga0075436_100220295 3300006914 Bacteria 1346
39 Ga0097620_100712645 3300006931 Bacteria 1094
40 Ga0075435_100157464 3300007076 Bacteria 1912
41 Ga0105240_10006621 3300009093 Bacteria 17007
42 Ga0105240_12107898 3300009093 Unclassified 585
43 Ga0111539_10034355 3300009094 Bacteria 6149
44 Ga0111539_10231748 3300009094 Bacteria 2150
45 Ga0114129_10180837 3300009147 Bacteria 2869
46 Ga0114129_10595768 3300009147 Bacteria 1433
47 Ga0114129_10908273 3300009147 Unclassified 1115
48 Ga0105241_10498534 3300009174 Bacteria 1085
49 Ga0105248_10220601 3300009177 Bacteria 2135
50 Ga0105238_10000012 3300009551 Bacteria 258862
51 Ga0105249_10366859 3300009553 Unclassified 1463
52 Ga0105249_11799991 3300009553 Unclassified 685
53 Ga0105249_13078134 3300009553 Unclassified 536
54 Ga0157373_10092628 3300013100 Bacteria 2128
55 Ga0157371_10022748 3300013102 Bacteria 4586
56 Ga0157370_10207464 3300013104 Bacteria 1817
57 Ga0157374_11970618 3300013296 Bacteria 610
58 Ga0163162_12635455 3300013306 Unclassified 578
59 Ga0157372_10107284 3300013307 Bacteria 3195
60 Ga0157372_10116010 3300013307 Bacteria 3070
61 Ga0157372_10350858 3300013307 Bacteria 1719
62 Ga0157372_10382679 3300013307 Bacteria 1639
63 Ga0157372_10906811 3300013307 Bacteria 1022
64 Ga0157372_11223366 3300013307 Unclassified 868
65 Ga0157375_10935915 3300013308 Unclassified 1009
66 Ga0207695_10025560 3300025913 Bacteria 6608
67 Ga0207695_10650495 3300025913 Bacteria 935
68 Ga0207660_10472508 3300025917 Bacteria 1015
69 Ga0207694_10000025 3300025924 Bacteria 258871
70 Ga0207711_10022277 3300025941 Bacteria 5297
71 Ga0207667_10196928 3300025949 Bacteria 2067
72 Ga0207712_11318703 3300025961 Bacteria 645
73 Ga0207712_11584248 3300025961 Unclassified 587
74 Ga0207639_10011305 3300026041 Bacteria 6196
75 Ga0207639_11689370 3300026041 Bacteria 593
76 Ga0207678_10786902 3300026067 Bacteria 839
77 Ga0207641_10598924 3300026088 Bacteria 1079
78 Ga0207676_10832280 3300026095 Bacteria 902
79 Ga0207698_10648390 3300026142 Bacteria 1046
80 Ga0207428_10142165 3300027907 Bacteria 1831
81 Ga0268265_10000495 3300028380 Bacteria 41015
82 Ga0265318_10258192 3300028577 Unclassified 636
83 Ga0265323_10000082 3300028653 Bacteria 54153
84 Ga0265323_10078677 3300028653 Unclassified 1116
85 Ga0265336_10094296 3300028666 Bacteria 892
86 Ga0265338_10020790 3300028800 Bacteria 6882
87 Ga0265331_10483851 3300031250 Bacteria 557
88 Ga0265327_10122771 3300031251 Bacteria 1229
89 Ga0265327_10132453 3300031251 Bacteria 1172
90 Ga0265327_10167040 3300031251 Bacteria 1013
91 Ga0265316_10000526 3300031344 Bacteria 43191
92 Ga0265316_10062904 3300031344 Bacteria 2879
93 Ga0307514_10496470 3300031649 Bacteria 582
94 Ga0265314_10300342 3300031711 Bacteria 901
95 Ga0265342_10086198 3300031712 Bacteria 1806
96 Ga0307516_10006268 3300031730 Bacteria 13983
97 Ga0307405_10028161 3300031731 Bacteria 3268
98 Ga0307412_10029182 3300031911 Bacteria 3460
99 Ga0436361_1122604 3300039447 Bacteria 695
100 Ga0451577_0000232 3300042876 Bacteria 111987
101 Ga0451577_0000433 3300042876 Bacteria 74789
102 Ga0451577_0123732 3300042876 Unclassified 2317
103 Ga0466969_0027230 3300044656 Bacteria 2928
104 Ga0453683_0137622 3300044673 Bacteria 1540
105 Ga0453683_0144917 3300044673 Bacteria 1499
106 Ga0453683_0163337 3300044673 Bacteria 1409
107 Ga0466961_0002072 3300044693 Bacteria 12498
108 Ga0453684_0000212 3300044712 Bacteria 254110
109 Ga0453684_0002895 3300044712 Bacteria 40244
110 Ga0453684_0005218 3300044712 Bacteria 26054
111 Ga0453684_0764822 3300044712 Bacteria 1044
112 Ga0451576_0000689 3300045051 Bacteria 68784
113 Ga0451576_0002389 3300045051 Bacteria 28227
114 Ga0451576_0162096 3300045051 Bacteria 2334
115 Ga0451576_0166489 3300045051 Bacteria 2300
116 Ga0495643_0000104 3300046522 Bacteria 140570
117 Ga0495621_0535019 3300046539 Bacteria 508
118 Ga0495667_0023147 3300046559 Bacteria 4186
119 Ga0495672_0007077 3300047320 Bacteria 8506
120 Ga0501068_1072816 3300049584 Unclassified 532
121 Ga0501071_0471813 3300049587 Unclassified 961
122 Ga0501247_005922 3300049677 Bacteria 1373
123 nmdc:mga05p37_110005_c1 3300050507 Unclassified 3390
124 nmdc:mga05p37_68065_c1 3300050507 Bacteria 4379
125 nmdc:mga05p37_914463_c1 3300050507 Unclassified 944
126 nmdc:mga09592_276801_c1 3300050508 Bacteria 1456
127 nmdc:mga09592_44763_c1 3300050508 Unclassified 3727
128 nmdc:mga0qj67_140214_c1 3300050509 Unclassified 1960
129 nmdc:mga06r32_104938_c1 3300050510 Bacteria 2776
130 nmdc:mga06r32_93089_c1 3300050510 Bacteria 2947
131 nmdc:mga08y16_259509_c1 3300050511 Bacteria 1795
132 nmdc:mga08y16_45991_c1 3300050511 Bacteria 4572
133 nmdc:mga0n895_11634_c2 3300050512 Bacteria 6527
134 nmdc:mga0n895_784843_c1 3300050512 Unclassified 944
135 nmdc:mga0rr50_118888_c1 3300050513 Bacteria 2100
136 nmdc:mga08x19_158180_c1 3300050514 Bacteria 1538
137 nmdc:mga08x19_271563_c1 3300050514 Bacteria 1174
138 nmdc:mga0a205_469677_c1 3300050515 Unclassified 1117
139 Ga0500651_0285960 3300053093 Bacteria 950
140 Ga0500554_029836 3300053102 Bacteria 1597
141 Ga0500622_0020934 3300053156 Bacteria 3471
142 2928148651 2928147474 Bacteria 6512076
143 rootH2_10079526
144 JGI24739J22299_10035008
145 JGI25406J46586_10064239
146 JGI25406J46586_10218879
147 rootL2_10280160
148 rootL2_10352417
149 Ga0065712_10554551
150 Ga0065715_10499526
151 Ga0070666_10043301
152 Ga0070680_100544587
153 Ga0070708_100982894
154 Ga0070699_100216026
155 Ga0068853_100117673
156 Ga0068853_100505557
157 Ga0070686_100167587
158 Ga0070696_100006445
159 Ga0070693_100522452
160 Ga0068854_100492134
161 Ga0068856_101562271
162 Ga0068859_100712590
163 Ga0068863_100528907
164 Ga0068862_100000918
165 Ga0081455_10415236
166 Ga0081539_10028486
167 Ga0081539_10049194
168 Ga0081539_10345590
169 Ga0075428_100265548
170 Ga0075428_101922993
171 Ga0075430_100565732
172 Ga0075431_100219691
173 Ga0075431_100240164
174 Ga0075433_10679957
175 Ga0075434_100053712
176 Ga0075434_100745063
177 Ga0075429_100025528
178 Ga0075429_100315167
179 Ga0075436_100092727
180 Ga0075436_100220295
181 Ga0097620_100712645
182 Ga0075435_100157464
183 Ga0105240_10006621
184 Ga0105240_12107898
185 Ga0111539_10034355
186 Ga0111539_10231748
187 Ga0114129_10180837
188 Ga0114129_10595768
189 Ga0114129_10908273
190 Ga0105241_10498534
191 Ga0105248_10220601
192 Ga0105238_10000012
193 Ga0105249_10366859
194 Ga0105249_11799991
195 Ga0105249_13078134
196 Ga0157373_10092628
197 Ga0157371_10022748
198 Ga0157370_10207464
199 Ga0157374_11970618
200 Ga0163162_12635455
201 Ga0157372_10107284
202 Ga0157372_10116010
203 Ga0157372_10350858
204 Ga0157372_10382679
205 Ga0157372_10906811
206 Ga0157372_11223366
207 Ga0157375_10935915
208 Ga0207695_10025560
209 Ga0207695_10650495
210 Ga0207660_10472508
211 Ga0207694_10000025
212 Ga0207711_10022277
213 Ga0207667_10196928
214 Ga0207712_11318703
215 Ga0207712_11584248
216 Ga0207639_10011305
217 Ga0207639_11689370
218 Ga0207678_10786902
219 Ga0207641_10598924
220 Ga0207676_10832280
221 Ga0207698_10648390
222 Ga0207428_10142165
223 Ga0268265_10000495
224 Ga0265318_10258192
225 Ga0265323_10000082
226 Ga0265323_10078677
227 Ga0265336_10094296
228 Ga0265338_10020790
229 Ga0265331_10483851
230 Ga0265327_10122771
231 Ga0265327_10132453
232 Ga0265327_10167040
233 Ga0265316_10000526
234 Ga0265316_10062904
235 Ga0307514_10496470
236 Ga0265314_10300342
237 Ga0265342_10086198
238 Ga0307516_10006268
239 Ga0307405_10028161
240 Ga0307412_10029182
241 Ga0436361_1122604
242 Ga0451577_0000232
243 Ga0451577_0000433
244 Ga0451577_0123732
245 Ga0466969_0027230
246 Ga0453683_0137622
247 Ga0453683_0144917
248 Ga0453683_0163337
249 Ga0466961_0002072
250 Ga0453684_0000212
251 Ga0453684_0002895
252 Ga0453684_0005218
253 Ga0453684_0764822
254 Ga0451576_0000689
255 Ga0451576_0002389
256 Ga0451576_0162096
257 Ga0451576_0166489
258 Ga0495643_0000104
259 Ga0495621_0535019
260 Ga0495667_0023147
261 Ga0495672_0007077
262 Ga0501068_1072816
263 Ga0501071_0471813
264 Ga0501247_005922
265 nmdc:mga05p37_110005_c1
266 nmdc:mga05p37_68065_c1
267 nmdc:mga05p37_914463_c1
268 nmdc:mga09592_276801_c1
269 nmdc:mga09592_44763_c1
270 nmdc:mga0qj67_140214_c1
271 nmdc:mga06r32_104938_c1
272 nmdc:mga06r32_93089_c1
273 nmdc:mga08y16_259509_c1
274 nmdc:mga08y16_45991_c1
275 nmdc:mga0n895_11634_c2
276 nmdc:mga0n895_784843_c1
277 nmdc:mga0rr50_118888_c1
278 nmdc:mga08x19_158180_c1
279 nmdc:mga08x19_271563_c1
280 nmdc:mga0a205_469677_c1
281 Ga0500651_0285960
282 Ga0500554_029836
283 Ga0500622_0020934
284 2928148651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w8i-assembly1.cif.gz_A-2 the structure of gene product af1683 from archaeoglobus fulgidus. 0.7558 6 120
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.749 8 120
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.7476 8 114
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.7308 7 122
2mdt-assembly1.cif.gz_A a pilt n-terminus domain protein sso1118 from hyperthemophilic archaeon sulfolobus solfataricus p2 0.7092 6 156
ID Description Score Start End Superfamily
af_P9WF55_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7937 8 118 3.40.50.1010
af_O53501_3_137_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7684 10 118 3.40.50.1010
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.767 9 118 3.40.50.1010
af_P9WF89_1_125_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7572 8 131 3.40.50.1010
1w8iA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7565 8 120 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A4Q9BE74-F1-model_v4 PIN domain protein 0.9962 4 151
AF-A0A7V4JLP3-F1-model_v4 PIN domain protein 0.9932 4 152
AF-A0A6L8ATF6-F1-model_v4 deleted 0.9925 4 151
AF-A0A7C8ETD3-F1-model_v4 PIN domain-containing protein 0.9905 4 151
AF-A0A1H5TV00-F1-model_v4 PIN domain-containing protein 0.9889 4 141

Map