F184224

General Info

Members Datasets Scaffolds Average Seq Length
141 123 79 497

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939702853|2939706852
Length 562
Sequence PSSDVRWQPCCADCACWRKPWQPFYELVYTLWYSSAKAKEAEAGNAPYIYGACAAFLRNGGLDMSATLTIVGLGSGDPDQLTIGILNKMRGASALYLRTKEHPAVQVLDEFEVAFESFDTLYETKESFPEVYEEITSQLIAAAAKAVDGSEIVYAVPGHPMVAEAAVQLLKERCPAQDIKLNILGGESFLDEAFVRLGFDPIEGFQLLDAGTLDASWLQPQLHTLIGQVYDTFTASDVKLCLMERYPDDYEVYVGHALGVEGEEAVHKVPLYELDRVEGYGNLSLVYIPRSEDDALKRRSFDRLHEIVDILRSPEGCPWDREQTHQSIRKNLIEETYEVIETIDEDDPDHMKEELGDLLLQILLHAQMEEEVGTFNVYDVIQGLNEKLIFRHPHVFGDHQAKDAEEALQSWEQMKAEEKRMKGTASAQPSVLDGVPRDLPALMKSYKLQKKAAKVGFNWDGIEGVFEKLDEEVAELKEAFREGHSVEAQLLELGDVLFVAVNAARFMGVDPEEALSATNRKFIDRFQYIEKRLREQGRRPEDSSVDEMEMYWQEAKKTLGRF

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
4 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
5 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
6 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
7 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
8 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
9 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
10 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
11 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
12 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
13 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
14 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
15 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
16 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
17 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
18 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
19 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
20 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
21 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
22 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
23 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
24 2857472729 Cohnella sp. R-74144 Isolate Unclassified
25 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
26 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
27 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
28 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
29 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
30 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
31 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
32 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
33 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
34 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
35 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
36 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
37 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
38 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
39 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
40 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
41 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
42 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
43 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
44 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
45 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
46 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
47 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
48 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
49 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
50 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
51 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
52 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
53 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
54 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
55 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
56 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
57 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
58 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
59 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
85 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
99 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
100 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
106 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
107 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
108 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
119 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
120 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
121 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
122 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
123 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 55.32
Metatranscriptomes 0.71
Isolates 43.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.38
Nodule 0.71
Rhizoplane 2.13
Rhizosphere 59.57
Stem 0
Stem Tuber 0
Unclassified 31.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000176 3300003751 Bacteria 41284
2 Ga0055541_1000158 3300003841 Bacteria 33250
3 Ga0070683_100054152 3300005329 Bacteria 3720
4 Ga0070674_100114007 3300005356 Bacteria 1990
5 Ga0070706_100010667 3300005467 Bacteria 8531
6 Ga0070707_100004411 3300005468 Bacteria 13185
7 Ga0070698_100028315 3300005471 Bacteria 5821
8 Ga0070686_100016042 3300005544 Bacteria 4352
9 Ga0105251_10003372 3300009011 Bacteria 11623
10 Ga0114129_10051078 3300009147 Bacteria 5806
11 Ga0105246_10000429 3300011119 Bacteria 22430
12 Ga0157371_10003316 3300013102 Bacteria 14716
13 Ga0157371_10036008 3300013102 Bacteria 3545
14 Ga0206349_1571573 3300020075 Bacteria 2946
15 Ga0209784_100151 3300025224 Bacteria 63336
16 Ga0209566_100116 3300025225 Bacteria 107510
17 Ga0209566_100196 3300025225 Bacteria 62620
18 Ga0209147_100136 3300025229 Bacteria 117683
19 Ga0209437_100517 3300025233 Bacteria 27191
20 Ga0209258_103531 3300025242 Bacteria 3328
21 Ga0209025_1018837 3300025294 Bacteria 3883
22 Ga0207655_1016649 3300025728 Bacteria 4010
23 Ga0207713_1017454 3300025735 Bacteria 3597
24 Ga0207684_10002591 3300025910 Bacteria 18113
25 Ga0207671_10102231 3300025914 Bacteria 2172
26 Ga0207646_10024101 3300025922 Bacteria 5578
27 Ga0207646_10109440 3300025922 Bacteria 2479
28 Ga0207664_10151866 3300025929 Bacteria 1968
29 Ga0307408_100097257 3300031548 Bacteria 2236
30 Ga0316578_10014475 3300031728 Bacteria 4215
31 Ga0316578_10075900 3300031728 Bacteria 1995
32 Ga0316577_10003231 3300031733 Bacteria 8193
33 Ga0307416_100045694 3300032002 Bacteria 3450
34 Ga0316582_0020401 3300036647 Bacteria 3897
35 Ga0316582_0052616 3300036647 Bacteria 2588
36 Ga0316584_0006398 3300036712 Bacteria 7975
37 Ga0395899_0076916 3300037312 Bacteria 2435
38 Ga0436363_0302450 3300039450 Bacteria 6436
39 Ga0466972_0030658 3300044658 Bacteria 2647
40 Ga0453683_0061606 3300044673 Bacteria 2346
41 Ga0466966_0003681 3300044684 Bacteria 10116
42 Ga0466961_0006805 3300044693 Bacteria 7274
43 Ga0453684_0046017 3300044712 Bacteria 5812
44 Ga0466957_0007603 3300044842 Bacteria 6126
45 Ga0466957_0039286 3300044842 Unclassified 2855
46 Ga0466959_0002127 3300045049 Bacteria 12543
47 Ga0466959_0004414 3300045049 Bacteria 9415
48 Ga0466959_0005167 3300045049 Bacteria 8894
49 Ga0495590_0023262 3300046457 Bacteria 2189
50 Ga0495591_017621 3300046458 Bacteria 2446
51 Ga0495660_0012566 3300046810 Bacteria 4916
52 Ga0495674_0050653 3300047319 Bacteria 3664
53 Ga0495681_0038930 3300047470 Bacteria 2326
54 Ga0496108_0000127 3300048911 Bacteria 75144
55 Ga0496110_0010663 3300048913 Bacteria 7482
56 Ga0496116_0000596 3300048919 Bacteria 48028
57 Ga0496116_0002532 3300048919 Bacteria 19139
58 Ga0496116_0025331 3300048919 Bacteria 4363
59 Ga0496116_0036940 3300048919 Bacteria 3413
60 Ga0496117_0007677 3300048920 Bacteria 10446
61 Ga0496117_0015754 3300048920 Bacteria 6420
62 Ga0496119_0000682 3300048922 Bacteria 45362
63 Ga0496120_0000678 3300048923 Bacteria 49988
64 Ga0496120_0013563 3300048923 Bacteria 5479
65 Ga0496121_0014745 3300048924 Bacteria 8257
66 Ga0496122_0022509 3300048925 Bacteria 5598
67 Ga0496122_0026434 3300048925 Bacteria 5004
68 Ga0496122_0030603 3300048925 Bacteria 4505
69 Ga0496123_0017596 3300048926 Bacteria 5740
70 Ga0496124_0000542 3300048927 Bacteria 64211
71 Ga0496125_0000920 3300048928 Bacteria 46265
72 Ga0496125_0021967 3300048928 Bacteria 5935
73 Ga0496126_0009873 3300048929 Bacteria 10096
74 Ga0496126_0021626 3300048929 Bacteria 6281
75 Ga0496126_0028699 3300048929 Bacteria 5298
76 Ga0501037_0098056 3300049573 Bacteria 2117
77 Ga0501038_0103427 3300049574 Bacteria 2368
78 Ga0501044_0016944 3300049823 Bacteria 7817
79 Ga0466962_0004229 3300061719 Bacteria 6877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0006398 Ga0316584_0006398_1260_2555 428
2 3300036647 Ga0316582_0020401 Ga0316582_0020401_165_1463 429
3 iso_pu_bacteria 2857591370 2857597504 451
4 3300044673 Ga0453683_0061606 Ga0453683_0061606_490_1905 464
5 3300044712 Ga0453684_0046017 Ga0453684_0046017_2733_4148 464
6 3300005468 Ga0070707_100004411 Ga0070707_1000044119 469
7 3300025922 Ga0207646_10109440 Ga0207646_101094402 469
8 3300031548 Ga0307408_100097257 Ga0307408_1000972571 473
9 3300031733 Ga0316577_10003231 Ga0316577_100032313 474
10 3300036647 Ga0316582_0052616 Ga0316582_0052616_175_1623 474
11 3300031728 Ga0316578_10014475 Ga0316578_100144755 475
12 3300025229 Ga0209147_100136 Ga0209147_100136131 477
13 3300025914 Ga0207671_10102231 Ga0207671_101022313 478
14 3300031728 Ga0316578_10075900 Ga0316578_100759002 478
15 3300013102 Ga0157371_10003316 Ga0157371_1000331610 480
16 3300048929 Ga0496126_0009873 Ga0496126_0009873_3942_5441 480
17 iso_pu_bacteria 2831905167 2831907850 480
18 iso_pu_bacteria 2977254563 2977254773 481
19 iso_pu_bacteria 2990275345 2990275772 481
20 iso_pu_bacteria 2936361878 2936363618 482
21 3300047319 Ga0495674_0050653 Ga0495674_0050653_96_1643 483
22 3300009147 Ga0114129_10051078 Ga0114129_100510784 485
23 3300020075 Ga0206349_1571573 Ga0206349_15715732 485
24 iso_pu_bacteria 2852673933 2852677312 485
25 iso_pu_bacteria 2898907183 2898908162 485
26 iso_pu_bacteria 2928510474 2928515299 485
27 3300032002 Ga0307416_100045694 Ga0307416_1000456945 486
28 3300048913 Ga0496110_0010663 Ga0496110_0010663_2069_3637 486
29 iso_pu_bacteria 2738541299 2738840638 486
30 3300044693 Ga0466961_0006805 Ga0466961_0006805_911_2428 487
31 iso_pu_bacteria 2915597211 2915598563 487
32 3300005329 Ga0070683_100054152 Ga0070683_1000541522 488
33 3300044658 Ga0466972_0030658 Ga0466972_0030658_409_1950 488
34 3300045049 Ga0466959_0005167 Ga0466959_0005167_3464_5005 488
35 iso_pu_bacteria 2512564013 2512639984 488
36 iso_pu_bacteria 2524023129 2524191674 488
37 iso_pu_bacteria 2929183550 2929183706 488
38 3300039450 Ga0436363_0302450 Ga0436363_0302450_1697_3223 489
39 3300048911 Ga0496108_0000127 Ga0496108_0000127_14090_15697 489
40 3300049573 Ga0501037_0098056 Ga0501037_0098056_506_2023 489
41 3300049574 Ga0501038_0103427 Ga0501038_0103427_791_2308 489
42 3300049823 Ga0501044_0016944 Ga0501044_0016944_65_1582 489
43 iso_pu_bacteria 2857472729 2857477570 489
44 3300044842 Ga0466957_0039286 Ga0466957_0039286_135_1655 490
45 iso_pu_bacteria 2857460504 2857464603 490
46 iso_pu_bacteria 2925326138 2925332247 490
47 iso_pu_bacteria 8002317523 8002323362 490
48 iso_pu_bacteria 8046991243 8046992181 490
49 3300005356 Ga0070674_100114007 Ga0070674_1001140071 491
50 3300048920 Ga0496117_0007677 Ga0496117_0007677_6958_8457 491
51 3300048923 Ga0496120_0013563 Ga0496120_0013563_3686_5185 491
52 3300048924 Ga0496121_0014745 Ga0496121_0014745_3371_4870 491
53 3300048926 Ga0496123_0017596 Ga0496123_0017596_470_1969 491
54 3300048928 Ga0496125_0000920 Ga0496125_0000920_24299_25798 491
55 iso_pu_bacteria 2510917027 2511176032 491
56 iso_pu_bacteria 2857465823 2857472226 491
57 iso_pu_bacteria 2915606848 2915609169 491
58 3300005544 Ga0070686_100016042 Ga0070686_1000160422 492
59 3300045049 Ga0466959_0004414 Ga0466959_0004414_5327_6841 492
60 iso_pu_bacteria 2563366752 2563930518 492
61 iso_pu_bacteria 2907202186 2907205042 492
62 iso_pu_bacteria 8057733483 8057735791 492
63 3300044684 Ga0466966_0003681 Ga0466966_0003681_4539_6077 493
64 3300044842 Ga0466957_0007603 Ga0466957_0007603_1329_2867 493
65 3300045049 Ga0466959_0002127 Ga0466959_0002127_8356_9894 493
66 3300061719 Ga0466962_0004229 Ga0466962_0004229_2485_4023 493
67 iso_pu_bacteria 2643221543 2643738710 493
68 iso_pu_bacteria 2864733723 2864738796 493
69 iso_pu_bacteria 2885526491 2885529798 493
70 iso_pu_bacteria 2889042446 2889042496 493
71 iso_pu_bacteria 2904162308 2904167363 493
72 iso_pu_bacteria 2904490793 2904496877 493
73 iso_pu_bacteria 2919160200 2919166167 493
74 iso_pu_bacteria 2931384279 2931385922 493
75 iso_pu_bacteria 2939679117 2939685050 493
76 iso_pu_bacteria 2945991243 2945995476 493
77 iso_pu_bacteria 2946053406 2946058181 493
78 3300025225 Ga0209566_100116 Ga0209566_10011646 494
79 3300025929 Ga0207664_10151866 Ga0207664_101518662 494
80 iso_pu_bacteria 2576861424 2578334556 494
81 iso_pu_bacteria 2821111986 2821118242 494
82 iso_pu_bacteria 2971511577 2971513864 494
83 iso_pu_bacteria 2980176882 2980179585 494
84 iso_pu_bacteria 2548877040 2550904067 495
85 iso_pu_bacteria 2571042143 2571530451 495
86 iso_pu_bacteria 2600255286 2601636891 495
87 iso_pu_bacteria 2721755693 2723601393 495
88 iso_pu_bacteria 2728368933 2728529762 495
89 iso_pu_bacteria 2728369359 2730137516 495
90 iso_pu_bacteria 2751185905 2753813003 495
91 iso_pu_bacteria 2802428803 2802440547 495
92 iso_pu_bacteria 2889276214 2889277487 495
93 iso_pu_bacteria 2904595352 2904601034 495
94 iso_pu_bacteria 2938649242 2938653471 495
95 iso_pu_bacteria 2968558590 2968562239 495
96 iso_pu_bacteria 2971403814 2971406927 495
97 iso_pu_bacteria 2988225383 2988230083 495
98 iso_pu_bacteria 2996632988 2996637410 495
99 iso_pu_bacteria 2996706504 2996711021 495
100 iso_pu_bacteria 648028048 648167977 495
101 iso_pu_bacteria 8054465665 8054468541 495
102 3300003841 Ga0055541_1000158 Ga0055541_10001584 496
103 3300013102 Ga0157371_10036008 Ga0157371_100360081 496
104 3300025225 Ga0209566_100196 Ga0209566_10019634 496
105 3300025242 Ga0209258_103531 Ga0209258_1035314 496
106 3300025294 Ga0209025_1018837 Ga0209025_10188373 496
107 3300025922 Ga0207646_10024101 Ga0207646_100241016 496
108 3300048919 Ga0496116_0025331 Ga0496116_0025331_860_2350 496
109 iso_pu_bacteria 2579778775 2580931975 496
110 iso_pu_bacteria 2619619294 2621272583 496
111 iso_pu_bacteria 2881636855 2881639568 496
112 3300009011 Ga0105251_10003372 Ga0105251_100033728 497
113 3300011119 Ga0105246_10000429 Ga0105246_100004298 497
114 3300025233 Ga0209437_100517 Ga0209437_1005175 497
115 3300025728 Ga0207655_1016649 Ga0207655_10166496 497
116 3300025735 Ga0207713_1017454 Ga0207713_10174545 497
117 3300048919 Ga0496116_0000596 Ga0496116_0000596_12581_14074 497
118 3300048925 Ga0496122_0026434 Ga0496122_0026434_365_1909 497
119 3300048928 Ga0496125_0021967 Ga0496125_0021967_3940_5502 497
120 3300005467 Ga0070706_100010667 Ga0070706_1000106676 498
121 3300005471 Ga0070698_100028315 Ga0070698_1000283154 498
122 3300025910 Ga0207684_10002591 Ga0207684_100025914 498
123 3300048919 Ga0496116_0002532 Ga0496116_0002532_10988_12508 498
124 3300048920 Ga0496117_0015754 Ga0496117_0015754_2101_3633 498
125 3300048922 Ga0496119_0000682 Ga0496119_0000682_11120_12652 498
126 3300048923 Ga0496120_0000678 Ga0496120_0000678_32669_34252 498
127 3300048925 Ga0496122_0022509 Ga0496122_0022509_2557_4089 498
128 3300048925 Ga0496122_0030603 Ga0496122_0030603_1598_3163 498
129 3300048927 Ga0496124_0000542 Ga0496124_0000542_29984_31516 498
130 3300048929 Ga0496126_0021626 Ga0496126_0021626_2476_4008 498
131 3300048929 Ga0496126_0028699 Ga0496126_0028699_2494_4059 498
132 3300046457 Ga0495590_0023262 Ga0495590_0023262_241_1740 499
133 3300046458 Ga0495591_017621 Ga0495591_017621_710_2209 499
134 3300046810 Ga0495660_0012566 Ga0495660_0012566_218_1717 499
135 3300047470 Ga0495681_0038930 Ga0495681_0038930_348_1847 499
136 3300048919 Ga0496116_0036940 Ga0496116_0036940_388_1887 499
137 iso_pu_bacteria 2939702853 2939706852 499
138 3300037312 Ga0395899_0076916 Ga0395899_0076916_81_1583 500
139 iso_pu_bacteria 2571042588 2573041643 500
140 3300003751 Ga0055538_1000176 Ga0055538_100017620 505
141 3300025224 Ga0209784_100151 Ga0209784_10015130 505

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

323

396

0.99

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

67

275

0.87

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

461

529

0.87

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

441

522

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cws-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.9286 400 445
7yh5-assembly3.cif.gz_F-2 mazg(mycobacterium tuberculosis) 0.8921 243 322
2djv-assembly1.cif.gz_A solution structures of the whep-trs domain of human methionyl-trna synthetase 0.8535 400 448
6ahx-assembly1.cif.gz_A-2 copper-sensing operon regulator protein (csorgz) 0.8499 396 445
7twl-assembly2.cif.gz_C structure of a borosin methyltransferase from mycena rosella with peptide a2 (mroma2) in complex with sah 0.818 1 236
ID Description Score Start End Superfamily
3crcA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9619 240 331 1.10.287.1080
af_P0AEY3_1_125_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9551 240 358 1.10.287.1080
af_Q2G0R6_120_231_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9535 125 234 3.30.950.10
3crcB02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9524 368 495 1.10.287.1080
3craB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9484 240 326 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A1I0K3F0-F1-model_v4 MazG family protein 0.9845 237 360 GO:0006203
GO:0008168
GO:0032259
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A5C7ZRG5-F1-model_v4 MazG family protein 0.9825 238 361 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-A0A0F9Z146-F1-model_v4 Tetrapyrrole methyltransferase domain-containing/MazG-like protein domain-containing protein, dITP/XTP pyrophosphatase (EC 3.6.1.19) 0.9793 239 355 GO:0006203
GO:0008168
GO:0032259
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-G5SG70-F1-model_v4 Nucleoside triphosphate pyrophosphohydrolase MazG 0.9779 241 358 GO:0006203
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429
AF-B2KAT1-F1-model_v4 Protein containing tetrapyrrole methyltransferase domain and MazG-like (Predicted pyrophosphatase) domain 0.9737 236 360 GO:0006203
GO:0008168
GO:0032259
GO:0046047
GO:0046052
GO:0046061
GO:0046076
GO:0046081
GO:0047429

Feature Viewer

pLDDT pTM Quality
87.61 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map