F183495

General Info

Members Datasets Scaffolds Average Seq Length
141 63 141 255

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0339731|Ga0453684_0339731_379_1266
Length 295
Sequence LHTSPDQYVIARIGATKQSPRRWELPGKVHPQRHKNDNMKRDLYFSKPIMNAAGSLGFAPDPRNGIDLDSFGAFITNPISLRPRLPAAQPALIEFPGGFLMHSGLPNPGLSSVLKKHGARWNRADIPILVNLMADRPEETQQMVRSLENIENVMAVELGFAPLLSDDIILLNLEMCVGELPLIFSLPAEQVLSLGPKLIQGGAAAISISSPRGALPLTSASSAKKSGRLVTGRLYGRSLFPRSLDIVRSAAMIGIPVIGAGGVWTNQDAADMLSAGAMAVETDAELWVPKEALNN

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
34 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
35 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
42 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
43 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
44 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
45 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
46 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
47 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
48 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
49 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
50 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
51 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
52 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
53 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
54 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
55 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
56 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
57 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
58 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
59 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
60 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
61 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
62 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
63 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.29
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_939313 2162886006 Unclassified 2922
2 SwRhRL2b_contig_752001 2162886007 Bacteria 11830
3 Ga0065704_10071358 3300005289 Bacteria 11540
4 Ga0065704_10192937 3300005289 Bacteria 1181
5 Ga0065707_10000538 3300005295 Bacteria 42818
6 Ga0065707_10001517 3300005295 Bacteria 9984
7 Ga0065707_10083639 3300005295 Bacteria 8569
8 Ga0070689_100010919 3300005340 Bacteria 6489
9 Ga0070689_100035833 3300005340 Bacteria 3792
10 Ga0070689_100257670 3300005340 Bacteria 1441
11 Ga0070708_100459515 3300005445 Bacteria 1201
12 Ga0070706_100057760 3300005467 Bacteria 3581
13 Ga0070707_100115170 3300005468 Bacteria 2609
14 Ga0070698_100177511 3300005471 Bacteria 2069
15 Ga0070698_100211019 3300005471 Bacteria 1876
16 Ga0070698_100352046 3300005471 Bacteria 1404
17 Ga0070699_100001765 3300005518 Bacteria 19725
18 Ga0070699_100008312 3300005518 Bacteria 9001
19 Ga0070699_100122483 3300005518 Bacteria 2288
20 Ga0070699_100454032 3300005518 Unclassified 1162
21 Ga0070697_100227589 3300005536 Bacteria 1590
22 Ga0070695_100009496 3300005545 Bacteria 5793
23 Ga0070696_100313074 3300005546 Bacteria 1206
24 Ga0070696_100313437 3300005546 Bacteria 1205
25 Ga0070704_100234022 3300005549 Bacteria 1500
26 Ga0068859_100120307 3300005617 Bacteria 2692
27 Ga0068859_100311916 3300005617 Bacteria 1667
28 Ga0068862_100434835 3300005844 Bacteria 1234
29 Ga0081539_10022851 3300005985 Bacteria 4120
30 Ga0075427_10004537 3300006194 Bacteria 1952
31 Ga0075428_100011383 3300006844 Bacteria 9894
32 Ga0075428_100564326 3300006844 Bacteria 1216
33 Ga0075431_100032309 3300006847 Bacteria 5393
34 Ga0075433_10009726 3300006852 Bacteria 7701
35 Ga0075429_100018603 3300006880 Bacteria 6017
36 Ga0075429_100168185 3300006880 Bacteria 1921
37 Ga0075429_100260298 3300006880 Bacteria 1519
38 Ga0097620_100120305 3300006931 Bacteria 2692
39 Ga0097620_100311925 3300006931 Bacteria 1667
40 Ga0114129_10037145 3300009147 Bacteria 6877
41 Ga0114129_10074787 3300009147 Bacteria 4718
42 Ga0114129_10142980 3300009147 Unclassified 3278
43 Ga0114129_10470027 3300009147 Unclassified 1647
44 Ga0105243_10049337 3300009148 Bacteria 3320
45 Ga0105249_10043469 3300009553 Bacteria 4085
46 Ga0105249_10767175 3300009553 Bacteria 1027
47 Ga0105246_10035453 3300011119 Bacteria 3335
48 Ga0207684_10102013 3300025910 Unclassified 2453
49 Ga0207646_10111890 3300025922 Bacteria 2451
50 Ga0207670_10055875 3300025936 Bacteria 2670
51 Ga0207712_10066061 3300025961 Bacteria 2584
52 Ga0268265_10693845 3300028380 Bacteria 983
53 Ga0265334_10009343 3300028573 Unclassified 4149
54 Ga0265334_10086549 3300028573 Bacteria 1148
55 Ga0265318_10053757 3300028577 Bacteria 1509
56 Ga0265338_10014290 3300028800 Bacteria 8849
57 Ga0265320_10022361 3300031240 Bacteria 3384
58 Ga0265320_10059649 3300031240 Bacteria 1824
59 Ga0265340_10019281 3300031247 Bacteria 3511
60 Ga0265316_10072510 3300031344 Bacteria 2653
61 Ga0307410_10191627 3300031852 Bacteria 1555
62 Ga0307415_100605631 3300032126 Bacteria 976
63 Ga0373928_0075052 3300035084 Unclassified 843
64 Ga0373932_0019458 3300035112 Bacteria 1770
65 Ga0316581_0027096 3300037588 Unclassified 1713
66 Ga0400484_38345 3300038725 Bacteria 1820
67 Ga0451577_0004964 3300042876 Bacteria 13821
68 Ga0451577_0015702 3300042876 Bacteria 7033
69 Ga0451577_0169844 3300042876 Unclassified 1965
70 Ga0451577_0186626 3300042876 Bacteria 1870
71 Ga0451577_0205313 3300042876 Bacteria 1779
72 Ga0451577_0335921 3300042876 Unclassified 1370
73 Ga0451577_0383817 3300042876 Bacteria 1275
74 Ga0451577_0699914 3300042876 Bacteria 918
75 Ga0453683_0004647 3300044673 Bacteria 9687
76 Ga0453683_0039905 3300044673 Bacteria 2950
77 Ga0453683_0142499 3300044673 Bacteria 1513
78 Ga0453683_0242388 3300044673 Bacteria 1148
79 Ga0453683_0290921 3300044673 Bacteria 1044
80 Ga0453684_0000035 3300044712 Bacteria 725956
81 Ga0453684_0000402 3300044712 Bacteria 178427
82 Ga0453684_0001521 3300044712 Bacteria 64957
83 Ga0453684_0004370 3300044712 Bacteria 29977
84 Ga0453684_0009490 3300044712 Bacteria 17017
85 Ga0453684_0012513 3300044712 Bacteria 13973
86 Ga0453684_0018332 3300044712 Bacteria 10755
87 Ga0453684_0035784 3300044712 Bacteria 6857
88 Ga0453684_0058003 3300044712 Bacteria 5004
89 Ga0453684_0065953 3300044712 Bacteria 4612
90 Ga0453684_0087039 3300044712 Bacteria 3874
91 Ga0453684_0095668 3300044712 Bacteria 3650
92 Ga0453684_0096064 3300044712 Bacteria 3642
93 Ga0453684_0105605 3300044712 Bacteria 3434
94 Ga0453684_0110150 3300044712 Bacteria 3347
95 Ga0453684_0134944 3300044712 Bacteria 2957
96 Ga0453684_0141978 3300044712 Unclassified 2866
97 Ga0453684_0165334 3300044712 Unclassified 2613
98 Ga0453684_0199365 3300044712 Bacteria 2334
99 Ga0453684_0206762 3300044712 Bacteria 2284
100 Ga0453684_0264701 3300044712 Bacteria 1968
101 Ga0453684_0269191 3300044712 Unclassified 1948
102 Ga0453684_0339731 3300044712 Bacteria 1696
103 Ga0453684_0589323 3300044712 Bacteria 1220
104 Ga0453684_0680700 3300044712 Bacteria 1120
105 Ga0453684_0682840 3300044712 Unclassified 1117
106 Ga0453684_0725793 3300044712 Bacteria 1077
107 Ga0453684_0746699 3300044712 Unclassified 1059
108 Ga0453684_0847399 3300044712 Bacteria 982
109 Ga0453684_1130831 3300044712 Bacteria 826
110 Ga0451576_0000192 3300045051 Bacteria 154140
111 Ga0451576_0002907 3300045051 Bacteria 24422
112 Ga0451576_0015115 3300045051 Bacteria 8568
113 Ga0451576_0048196 3300045051 Bacteria 4477
114 Ga0451576_0099578 3300045051 Bacteria 3024
115 Ga0451576_0121184 3300045051 Bacteria 2723
116 Ga0451576_0127675 3300045051 Bacteria 2650
117 Ga0451576_0281627 3300045051 Bacteria 1738
118 Ga0451576_0394340 3300045051 Bacteria 1451
119 Ga0451576_0703845 3300045051 Bacteria 1061
120 Ga0451576_0959766 3300045051 Unclassified 896
121 Ga0501071_0334529 3300049587 Bacteria 1151
122 Ga0501074_0102880 3300049590 Bacteria 2045
123 Ga0501075_0047032 3300049591 Bacteria 3242
124 Ga0501076_0045093 3300049592 Bacteria 3480
125 Ga0501076_0047506 3300049592 Unclassified 3394
126 Ga0501079_0024479 3300049741 Bacteria 4633
127 Ga0501080_0111838 3300049742 Bacteria 2531
128 Ga0501081_0031002 3300049743 Bacteria 3622
129 Ga0501045_0145613 3300049824 Bacteria 1762
130 nmdc:mga05p37_220766_c1 3300050507 Bacteria 2287
131 nmdc:mga05p37_388154_c1 3300050507 Bacteria 1634
132 nmdc:mga05p37_6470_c1 3300050507 Bacteria 13817
133 nmdc:mga09592_173322_c1 3300050508 Unclassified 1866
134 nmdc:mga09592_340367_c1 3300050508 Unclassified 1298
135 nmdc:mga09592_6656_c1 3300050508 Bacteria 9411
136 nmdc:mga09592_98918_c1 3300050508 Bacteria 2497
137 nmdc:mga0qj67_144617_c1 3300050509 Bacteria 1928
138 nmdc:mga06r32_457259_c1 3300050510 Bacteria 1256
139 nmdc:mga0a205_11543_c1 3300050515 Bacteria 8139
140 Ga0501084_0102190 3300054114 Bacteria 2407
141 Ga0501082_0163674 3300060353 Bacteria 1933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0959766 Ga0451576_0959766_17_733 226
2 3300044712 Ga0453684_0000035 Ga0453684_0000035_649753_650517 231
3 3300042876 Ga0451577_0699914 Ga0451577_0699914_172_876 232
4 3300006844 Ga0075428_100564326 Ga0075428_1005643262 237
5 3300044673 Ga0453683_0004647 Ga0453683_0004647_8432_9181 237
6 3300045051 Ga0451576_0002907 Ga0451576_0002907_16763_17512 237
7 3300044712 Ga0453684_0012513 Ga0453684_0012513_5052_5900 242
8 3300044712 Ga0453684_0264701 Ga0453684_0264701_345_1109 243
9 3300044712 Ga0453684_0004370 Ga0453684_0004370_8035_8835 244
10 3300042876 Ga0451577_0015702 Ga0451577_0015702_1981_2751 245
11 3300042876 Ga0451577_0169844 Ga0451577_0169844_784_1560 245
12 3300044712 Ga0453684_0009490 Ga0453684_0009490_5342_6094 245
13 3300044712 Ga0453684_0087039 Ga0453684_0087039_1430_2206 245
14 3300005467 Ga0070706_100057760 Ga0070706_1000577603 246
15 3300005518 Ga0070699_100001765 Ga0070699_1000017656 246
16 3300006844 Ga0075428_100011383 Ga0075428_1000113832 246
17 3300009147 Ga0114129_10470027 Ga0114129_104700272 246
18 3300025910 Ga0207684_10102013 Ga0207684_101020134 246
19 3300028573 Ga0265334_10009343 Ga0265334_100093433 246
20 3300028577 Ga0265318_10053757 Ga0265318_100537572 246
21 3300028800 Ga0265338_10014290 Ga0265338_100142902 246
22 3300031240 Ga0265320_10059649 Ga0265320_100596491 246
23 3300031247 Ga0265340_10019281 Ga0265340_100192814 246
24 3300031344 Ga0265316_10072510 Ga0265316_100725103 246
25 3300042876 Ga0451577_0335921 Ga0451577_0335921_146_892 246
26 3300044673 Ga0453683_0290921 Ga0453683_0290921_73_822 246
27 3300044712 Ga0453684_0001521 Ga0453684_0001521_50689_51486 246
28 3300044712 Ga0453684_0058003 Ga0453684_0058003_1805_2551 246
29 3300044712 Ga0453684_0096064 Ga0453684_0096064_1616_2371 246
30 3300044712 Ga0453684_0110150 Ga0453684_0110150_1512_2267 246
31 3300044712 Ga0453684_0165334 Ga0453684_0165334_1162_1932 246
32 3300044712 Ga0453684_0206762 Ga0453684_0206762_423_1172 246
33 3300044712 Ga0453684_0269191 Ga0453684_0269191_106_864 246
34 3300045051 Ga0451576_0000192 Ga0451576_0000192_122792_123550 246
35 3300045051 Ga0451576_0048196 Ga0451576_0048196_1408_2157 246
36 3300045051 Ga0451576_0394340 Ga0451576_0394340_49_792 246
37 3300005295 Ga0065707_10001517 Ga0065707_100015177 247
38 3300042876 Ga0451577_0004964 Ga0451577_0004964_3753_4502 247
39 3300042876 Ga0451577_0205313 Ga0451577_0205313_695_1444 247
40 3300044673 Ga0453683_0142499 Ga0453683_0142499_671_1429 247
41 3300044712 Ga0453684_0018332 Ga0453684_0018332_999_1757 247
42 3300044712 Ga0453684_0065953 Ga0453684_0065953_413_1171 247
43 3300044712 Ga0453684_0095668 Ga0453684_0095668_2403_3221 247
44 3300044712 Ga0453684_0105605 Ga0453684_0105605_1046_1795 247
45 3300044712 Ga0453684_0199365 Ga0453684_0199365_1072_1821 247
46 3300044712 Ga0453684_0682840 Ga0453684_0682840_108_866 247
47 3300044712 Ga0453684_0746699 Ga0453684_0746699_194_952 247
48 3300044712 Ga0453684_1130831 Ga0453684_1130831_28_777 247
49 3300045051 Ga0451576_0099578 Ga0451576_0099578_1707_2465 247
50 3300045051 Ga0451576_0281627 Ga0451576_0281627_285_1043 247
51 3300045051 Ga0451576_0703845 Ga0451576_0703845_285_1043 247
52 3300005340 Ga0070689_100035833 Ga0070689_1000358332 248
53 3300005471 Ga0070698_100177511 Ga0070698_1001775112 248
54 3300005617 Ga0068859_100120307 Ga0068859_1001203072 248
55 3300005844 Ga0068862_100434835 Ga0068862_1004348352 248
56 3300006931 Ga0097620_100120305 Ga0097620_1001203054 248
57 3300009147 Ga0114129_10142980 Ga0114129_101429803 248
58 3300009553 Ga0105249_10043469 Ga0105249_100434694 248
59 3300009553 Ga0105249_10767175 Ga0105249_107671752 248
60 3300025936 Ga0207670_10055875 Ga0207670_100558753 248
61 3300044712 Ga0453684_0035784 Ga0453684_0035784_5279_6031 248
62 3300045051 Ga0451576_0121184 Ga0451576_0121184_317_1069 248
63 3300038725 Ga0400484_38345 Ga0400484_38345_654_1454 249
64 3300044712 Ga0453684_0339731 Ga0453684_0339731_379_1266 250
65 3300005518 Ga0070699_100008312 Ga0070699_1000083127 251
66 3300006880 Ga0075429_100018603 Ga0075429_1000186037 251
67 3300006880 Ga0075429_100168185 Ga0075429_1001681852 251
68 3300006880 Ga0075429_100260298 Ga0075429_1002602982 251
69 3300009147 Ga0114129_10074787 Ga0114129_100747872 251
70 3300025961 Ga0207712_10066061 Ga0207712_100660612 251
71 3300028573 Ga0265334_10086549 Ga0265334_100865491 251
72 3300031240 Ga0265320_10022361 Ga0265320_100223613 251
73 3300042876 Ga0451577_0383817 Ga0451577_0383817_324_1085 251
74 3300044712 Ga0453684_0134944 Ga0453684_0134944_1747_2508 251
75 3300044712 Ga0453684_0141978 Ga0453684_0141978_124_885 251
76 3300044712 Ga0453684_0680700 Ga0453684_0680700_12_899 251
77 3300044712 Ga0453684_0725793 Ga0453684_0725793_78_854 251
78 3300044712 Ga0453684_0847399 Ga0453684_0847399_43_804 251
79 3300045051 Ga0451576_0127675 Ga0451576_0127675_667_1428 251
80 3300049587 Ga0501071_0334529 Ga0501071_0334529_266_1027 251
81 3300049590 Ga0501074_0102880 Ga0501074_0102880_645_1406 251
82 3300049591 Ga0501075_0047032 Ga0501075_0047032_1935_2696 251
83 3300049741 Ga0501079_0024479 Ga0501079_0024479_3011_3772 251
84 3300049742 Ga0501080_0111838 Ga0501080_0111838_546_1307 251
85 3300049743 Ga0501081_0031002 Ga0501081_0031002_1954_2715 251
86 3300049824 Ga0501045_0145613 Ga0501045_0145613_863_1624 251
87 3300050507 nmdc:mga05p37_220766_c1 nmdc:mga05p37_220766_c1_1268_2023 251
88 3300050508 nmdc:mga09592_173322_c1 nmdc:mga09592_173322_c1_1059_1814 251
89 3300050508 nmdc:mga09592_98918_c1 nmdc:mga09592_98918_c1_355_1110 251
90 3300050509 nmdc:mga0qj67_144617_c1 nmdc:mga0qj67_144617_c1_58_819 251
91 3300054114 Ga0501084_0102190 Ga0501084_0102190_982_1743 251
92 3300060353 Ga0501082_0163674 Ga0501082_0163674_240_1001 251
93 3300035084 Ga0373928_0075052 Ga0373928_0075052_67_825 252
94 3300035112 Ga0373932_0019458 Ga0373932_0019458_354_1112 252
95 3300044673 Ga0453683_0242388 Ga0453683_0242388_222_1004 252
96 2162886006 SwRhRL3b_contig_939313 SwRhRL3b_0445.00001100 253
97 2162886007 SwRhRL2b_contig_752001 SwRhRL2b_0010.00002580 253
98 3300005289 Ga0065704_10071358 Ga0065704_100713587 253
99 3300005289 Ga0065704_10192937 Ga0065704_101929372 253
100 3300005295 Ga0065707_10000538 Ga0065707_1000053832 253
101 3300005295 Ga0065707_10083639 Ga0065707_100836392 253
102 3300005340 Ga0070689_100010919 Ga0070689_1000109192 253
103 3300005340 Ga0070689_100257670 Ga0070689_1002576701 253
104 3300005445 Ga0070708_100459515 Ga0070708_1004595152 253
105 3300005468 Ga0070707_100115170 Ga0070707_1001151702 253
106 3300005471 Ga0070698_100211019 Ga0070698_1002110194 253
107 3300005471 Ga0070698_100352046 Ga0070698_1003520461 253
108 3300005518 Ga0070699_100122483 Ga0070699_1001224832 253
109 3300005518 Ga0070699_100454032 Ga0070699_1004540322 253
110 3300005536 Ga0070697_100227589 Ga0070697_1002275892 253
111 3300005545 Ga0070695_100009496 Ga0070695_1000094969 253
112 3300005546 Ga0070696_100313074 Ga0070696_1003130742 253
113 3300005546 Ga0070696_100313437 Ga0070696_1003134371 253
114 3300005549 Ga0070704_100234022 Ga0070704_1002340222 253
115 3300005617 Ga0068859_100311916 Ga0068859_1003119162 253
116 3300005985 Ga0081539_10022851 Ga0081539_100228515 253
117 3300006194 Ga0075427_10004537 Ga0075427_100045372 253
118 3300006847 Ga0075431_100032309 Ga0075431_1000323092 253
119 3300006852 Ga0075433_10009726 Ga0075433_100097264 253
120 3300006931 Ga0097620_100311925 Ga0097620_1003119253 253
121 3300009147 Ga0114129_10037145 Ga0114129_100371454 253
122 3300009148 Ga0105243_10049337 Ga0105243_100493372 253
123 3300011119 Ga0105246_10035453 Ga0105246_100354531 253
124 3300025922 Ga0207646_10111890 Ga0207646_101118902 253
125 3300028380 Ga0268265_10693845 Ga0268265_106938452 253
126 3300031852 Ga0307410_10191627 Ga0307410_101916272 253
127 3300032126 Ga0307415_100605631 Ga0307415_1006056311 253
128 3300037588 Ga0316581_0027096 Ga0316581_0027096_624_1436 253
129 3300042876 Ga0451577_0186626 Ga0451577_0186626_1088_1855 253
130 3300044673 Ga0453683_0039905 Ga0453683_0039905_456_1238 253
131 3300044712 Ga0453684_0000402 Ga0453684_0000402_164707_165474 253
132 3300044712 Ga0453684_0589323 Ga0453684_0589323_311_1144 253
133 3300045051 Ga0451576_0015115 Ga0451576_0015115_4553_5335 253
134 3300049592 Ga0501076_0045093 Ga0501076_0045093_2036_2821 253
135 3300049592 Ga0501076_0047506 Ga0501076_0047506_551_1348 253
136 3300050507 nmdc:mga05p37_388154_c1 nmdc:mga05p37_388154_c1_519_1310 253
137 3300050507 nmdc:mga05p37_6470_c1 nmdc:mga05p37_6470_c1_2153_2914 253
138 3300050508 nmdc:mga09592_340367_c1 nmdc:mga09592_340367_c1_14_793 253
139 3300050508 nmdc:mga09592_6656_c1 nmdc:mga09592_6656_c1_8037_8816 253
140 3300050510 nmdc:mga06r32_457259_c1 nmdc:mga06r32_457259_c1_67_852 253
141 3300050515 nmdc:mga0a205_11543_c1 nmdc:mga0a205_11543_c1_6243_7034 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01180

DHO_dh

Dihydroorotate dehydrogenase

39

160

0.94

PF01180

DHO_dh

Dihydroorotate dehydrogenase

204

290

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ep3-assembly1.cif.gz_A crystal structure of lactococcus lactis dihydroorotate dehydrogenase b. data collected under cryogenic conditions. 0.8725 7 246
5ue9-assembly1.cif.gz_A wt dhodb with orotate bound 0.8722 2 246
5ksw-assembly1.cif.gz_A dhodb-i74d mutant 0.8581 3 246
1ep2-assembly1.cif.gz_A-2 crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate 0.8469 7 246
5ue9-assembly1.cif.gz_A wt dhodb with orotate bound 0.8438 2 246
ID Description Score Start End Superfamily
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8772 7 246 3.20.20.70
af_Q58070_5_305_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8367 7 246 3.20.20.70
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8328 7 246 3.20.20.70
af_Q4D3W2_1_314_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8062 7 245 3.20.20.70
af_Q58070_5_305_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7947 7 246 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3A0BGB7-F1-model_v4 Dihydroorotate dehydrogenase catalytic domain-containing protein 0.9606 1 231 GO:0005737
GO:0016627
AF-A0A7C3KP67-F1-model_v4 Dihydroorotate dehydrogenase domain-containing protein 0.9481 1 251 GO:0004152
GO:0005737
GO:0006207
GO:0018580
GO:0044205
AF-A0A3A0BGB7-F1-model_v4 Dihydroorotate dehydrogenase catalytic domain-containing protein 0.9447 1 231 GO:0005737
GO:0016627
AF-A0A7C3KP67-F1-model_v4 Dihydroorotate dehydrogenase domain-containing protein 0.9444 1 251 GO:0004152
GO:0005737
GO:0006207
GO:0018580
GO:0044205
AF-A0A3N5LPN2-F1-model_v4 Dihydroorotate dehydrogenase catalytic domain-containing protein 0.9334 2 194 GO:0005737
GO:0016627

Feature Viewer

pLDDT pTM Quality
84.66 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map