F181723

General Info

Members Datasets Scaffolds Average Seq Length
141 72 141 299

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100000592|Ga0070669_10000059223
Length 328
Sequence MLKDGERMEQTGVVRETDGRAVPIAKALFSVVVWGASFIATKIALAEVQPMTVVWLRFAMGVAVLGAIVAVRRQLTVPSRSDLAYFAGLGFLGIAFHQWLQSTGLVTAQAGTTAWIVSSAPIFMALLGWLVLRERPSGLGAAGIAVAAVGVLVVVSRGDLAALTAGRFGTTGDFLILVSALNWTVFSVLSRKGLKRQSSAGGAAGMMFWVMTAGWLFSTIPFLLGPGPADAARLSARGWSAVAFLGIACSGLAYGFWYDALRVLPSSQAGAFLYLEPLVTVVVAAAMLAEPILPATLVGGGAILLGVWMVSARSHSHPTAKPRSAPES

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
53 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
54 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
61 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
62 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
63 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
64 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
65 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
66 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
67 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
68 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
69 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
70 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
71 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
72 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2229080 2162886006 Bacteria 1986
2 SwRhRL2b_contig_713755 2162886007 Bacteria 10197
3 Ga0065704_10100002 3300005289 Bacteria 2289
4 Ga0065707_10000492 3300005295 Bacteria 70979
5 Ga0065707_10087058 3300005295 Bacteria 5185
6 Ga0065707_10091817 3300005295 Bacteria 3861
7 Ga0070687_100090644 3300005343 Bacteria 1690
8 Ga0070669_100000592 3300005353 Bacteria 26958
9 Ga0070705_100170666 3300005440 Bacteria 1464
10 Ga0070708_100345249 3300005445 Unclassified 1402
11 Ga0070706_100109525 3300005467 Bacteria 2570
12 Ga0070706_100243093 3300005467 Bacteria 1681
13 Ga0070698_100562915 3300005471 Unclassified 1079
14 Ga0070699_100011111 3300005518 Bacteria 7782
15 Ga0070699_100064360 3300005518 Bacteria 3181
16 Ga0070699_100116799 3300005518 Bacteria 2345
17 Ga0070686_100186949 3300005544 Bacteria 1476
18 Ga0070695_100005519 3300005545 Bacteria 7450
19 Ga0068859_100170073 3300005617 Unclassified 2260
20 Ga0068859_100238642 3300005617 Bacteria 1907
21 Ga0068864_100114037 3300005618 Bacteria 2410
22 Ga0068870_10022564 3300005840 Bacteria 3094
23 Ga0068862_100000635 3300005844 Bacteria 36366
24 Ga0068862_100089947 3300005844 Bacteria 2672
25 Ga0068862_100255025 3300005844 Unclassified 1600
26 Ga0081539_10002559 3300005985 Bacteria 25210
27 Ga0081539_10068986 3300005985 Bacteria 1905
28 Ga0075428_100123302 3300006844 Bacteria 2820
29 Ga0075430_100042328 3300006846 Bacteria 3852
30 Ga0075430_100295954 3300006846 Unclassified 1339
31 Ga0075431_100039160 3300006847 Bacteria 4883
32 Ga0075431_100113140 3300006847 Bacteria 2801
33 Ga0075429_100011076 3300006880 Bacteria 7804
34 Ga0075429_100012637 3300006880 Bacteria 7322
35 Ga0075429_100047044 3300006880 Bacteria 3753
36 Ga0075429_100114715 3300006880 Bacteria 2355
37 Ga0075429_100325224 3300006880 Bacteria 1346
38 Ga0075436_100107232 3300006914 Bacteria 1948
39 Ga0097620_100170074 3300006931 Unclassified 2260
40 Ga0097620_100238634 3300006931 Bacteria 1907
41 Ga0075435_100139425 3300007076 Bacteria 2034
42 Ga0111539_10465971 3300009094 Bacteria 1471
43 Ga0114129_10001679 3300009147 Bacteria 30166
44 Ga0114129_10024203 3300009147 Bacteria 8605
45 Ga0114129_10057624 3300009147 Bacteria 5435
46 Ga0114129_10129406 3300009147 Bacteria 3469
47 Ga0114129_10407777 3300009147 Bacteria 1790
48 Ga0114129_10423592 3300009147 Unclassified 1750
49 Ga0114129_11097609 3300009147 Unclassified 996
50 Ga0105243_10038703 3300009148 Bacteria 3715
51 Ga0105249_10023004 3300009553 Bacteria 5587
52 Ga0105249_10166380 3300009553 Bacteria 2135
53 Ga0105249_10424700 3300009553 Unclassified 1364
54 Ga0105246_10004493 3300011119 Bacteria 8482
55 Ga0207643_10061142 3300025908 Bacteria 2151
56 Ga0207684_10100063 3300025910 Bacteria 2477
57 Ga0207681_10000021 3300025923 Bacteria 236982
58 Ga0207706_10081910 3300025933 Bacteria 2836
59 Ga0207709_10283727 3300025935 Bacteria 1224
60 Ga0207670_10207511 3300025936 Unclassified 1492
61 Ga0207712_10182449 3300025961 Bacteria 1650
62 Ga0207674_10608933 3300026116 Bacteria 1055
63 Ga0268265_10000494 3300028380 Bacteria 41019
64 Ga0265318_10001994 3300028577 Bacteria 11334
65 Ga0265338_10013287 3300028800 Bacteria 9310
66 Ga0265316_10084298 3300031344 Bacteria 2434
67 Ga0316575_10039898 3300031665 Bacteria 1854
68 Ga0316579_10002425 3300031691 Bacteria 7039
69 Ga0316576_10195505 3300031727 Bacteria 1524
70 Ga0316578_10111790 3300031728 Bacteria 1641
71 Ga0316578_10218055 3300031728 Bacteria 1147
72 Ga0307405_10118425 3300031731 Unclassified 1808
73 Ga0316577_10047780 3300031733 Bacteria 2390
74 Ga0307410_10187775 3300031852 Bacteria 1570
75 Ga0307407_10173000 3300031903 Bacteria 1424
76 Ga0307409_100412962 3300031995 Bacteria 1293
77 Ga0316574_0091541 3300035398 Bacteria 1939
78 Ga0316574_0322723 3300035398 Unclassified 980
79 Ga0316582_0026814 3300036647 Bacteria 3472
80 Ga0316582_0061201 3300036647 Bacteria 2415
81 Ga0316582_0362097 3300036647 Bacteria 998
82 Ga0316584_0017865 3300036712 Bacteria 5109
83 Ga0316584_0036861 3300036712 Bacteria 3630
84 Ga0316584_0142250 3300036712 Bacteria 1788
85 Ga0316584_0283017 3300036712 Bacteria 1204
86 Ga0316584_0298485 3300036712 Bacteria 1167
87 Ga0451577_0002692 3300042876 Bacteria 20712
88 Ga0451577_0008338 3300042876 Bacteria 10083
89 Ga0451577_0019458 3300042876 Bacteria 6242
90 Ga0451577_0022075 3300042876 Bacteria 5815
91 Ga0451577_0474949 3300042876 Bacteria 1135
92 Ga0453683_0104356 3300044673 Bacteria 1780
93 Ga0453683_0210775 3300044673 Bacteria 1234
94 Ga0453684_0000024 3300044712 Bacteria 819351
95 Ga0453684_0000055 3300044712 Bacteria 532014
96 Ga0453684_0000420 3300044712 Bacteria 172995
97 Ga0453684_0002193 3300044712 Bacteria 48647
98 Ga0453684_0006953 3300044712 Bacteria 21178
99 Ga0453684_0009997 3300044712 Bacteria 16349
100 Ga0453684_0032802 3300044712 Bacteria 7256
101 Ga0453684_0038619 3300044712 Bacteria 6523
102 Ga0453684_0040018 3300044712 Bacteria 6375
103 Ga0453684_0050773 3300044712 Bacteria 5450
104 Ga0453684_0077402 3300044712 Bacteria 4169
105 Ga0453684_0096171 3300044712 Bacteria 3639
106 Ga0453684_0097957 3300044712 Bacteria 3597
107 Ga0453684_0103702 3300044712 Bacteria 3474
108 Ga0453684_0113654 3300044712 Bacteria 3284
109 Ga0453684_0125516 3300044712 Bacteria 3090
110 Ga0453684_0164207 3300044712 Unclassified 2623
111 Ga0453684_0209741 3300044712 Bacteria 2265
112 Ga0453684_0232579 3300044712 Unclassified 2127
113 Ga0453684_0309661 3300044712 Bacteria 1792
114 Ga0453684_0322428 3300044712 Bacteria 1749
115 Ga0453684_0425450 3300044712 Bacteria 1482
116 Ga0453684_0454316 3300044712 Unclassified 1425
117 Ga0453684_0638512 3300044712 Bacteria 1163
118 Ga0451576_0011036 3300045051 Bacteria 10312
119 Ga0451576_0016413 3300045051 Bacteria 8174
120 Ga0451576_0057327 3300045051 Bacteria 4072
121 Ga0451576_0062649 3300045051 Bacteria 3876
122 Ga0451576_0283809 3300045051 Bacteria 1731
123 Ga0501042_0167598 3300049578 Unclassified 1585
124 Ga0501075_0060755 3300049591 Bacteria 2847
125 Ga0501076_0017107 3300049592 Bacteria 5507
126 Ga0501076_0039623 3300049592 Bacteria 3699
127 Ga0501079_0044577 3300049741 Bacteria 3422
128 Ga0501080_0045992 3300049742 Bacteria 4065
129 Ga0501081_0060934 3300049743 Bacteria 2616
130 nmdc:mga05p37_122681_c1 3300050507 Bacteria 3192
131 nmdc:mga05p37_278289_c1 3300050507 Bacteria 1997
132 nmdc:mga05p37_36278_c1 3300050507 Bacteria 6050
133 nmdc:mga05p37_75303_c1 3300050507 Bacteria 4154
134 nmdc:mga05p37_836591_c1 3300050507 Unclassified 1002
135 nmdc:mga09592_105872_c1 3300050508 Unclassified 2412
136 nmdc:mga0qj67_51261_c1 3300050509 Bacteria 3263
137 nmdc:mga06r32_579911_c1 3300050510 Bacteria 1094
138 nmdc:mga0rr50_133833_c1 3300050513 Bacteria 1988
139 nmdc:mga0a205_31475_c1 3300050515 Bacteria 5082
140 Ga0501084_0351959 3300054114 Bacteria 1244
141 Ga0501082_0033409 3300060353 Bacteria 4439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006846 Ga0075430_100295954 Ga0075430_1002959542 256
2 3300006880 Ga0075429_100325224 Ga0075429_1003252241 258
3 3300050508 nmdc:mga09592_105872_c1 nmdc:mga09592_105872_c1_1215_2099 258
4 3300005440 Ga0070705_100170666 Ga0070705_1001706662 274
5 3300005467 Ga0070706_100243093 Ga0070706_1002430932 274
6 3300006880 Ga0075429_100114715 Ga0075429_1001147152 274
7 3300009147 Ga0114129_10024203 Ga0114129_100242032 274
8 3300009147 Ga0114129_10129406 Ga0114129_101294063 274
9 3300050507 nmdc:mga05p37_122681_c1 nmdc:mga05p37_122681_c1_655_1542 274
10 3300050507 nmdc:mga05p37_36278_c1 nmdc:mga05p37_36278_c1_1309_2214 274
11 3300006880 Ga0075429_100012637 Ga0075429_1000126372 277
12 3300005343 Ga0070687_100090644 Ga0070687_1000906441 279
13 3300005844 Ga0068862_100000635 Ga0068862_1000006357 281
14 3300028380 Ga0268265_10000494 Ga0268265_1000049427 281
15 3300031665 Ga0316575_10039898 Ga0316575_100398983 285
16 3300035398 Ga0316574_0091541 Ga0316574_0091541_336_1193 285
17 3300036647 Ga0316582_0061201 Ga0316582_0061201_1237_2094 285
18 3300042876 Ga0451577_0474949 Ga0451577_0474949_88_975 287
19 3300005445 Ga0070708_100345249 Ga0070708_1003452492 289
20 3300036712 Ga0316584_0017865 Ga0316584_0017865_3862_4818 292
21 3300042876 Ga0451577_0002692 Ga0451577_0002692_8132_9010 292
22 3300044712 Ga0453684_0000055 Ga0453684_0000055_196295_197173 292
23 3300042876 Ga0451577_0019458 Ga0451577_0019458_1942_2823 293
24 3300042876 Ga0451577_0022075 Ga0451577_0022075_3512_4393 293
25 3300044712 Ga0453684_0002193 Ga0453684_0002193_20632_21513 293
26 3300044712 Ga0453684_0009997 Ga0453684_0009997_35_919 293
27 3300044712 Ga0453684_0032802 Ga0453684_0032802_2922_3803 293
28 3300044712 Ga0453684_0113654 Ga0453684_0113654_1288_2169 293
29 3300005295 Ga0065707_10087058 Ga0065707_100870583 294
30 3300005471 Ga0070698_100562915 Ga0070698_1005629151 294
31 3300005518 Ga0070699_100011111 Ga0070699_1000111112 294
32 3300005518 Ga0070699_100064360 Ga0070699_1000643602 294
33 3300005617 Ga0068859_100238642 Ga0068859_1002386422 294
34 3300005618 Ga0068864_100114037 Ga0068864_1001140371 294
35 3300005840 Ga0068870_10022564 Ga0068870_100225643 294
36 3300005844 Ga0068862_100089947 Ga0068862_1000899473 294
37 3300005844 Ga0068862_100255025 Ga0068862_1002550252 294
38 3300005985 Ga0081539_10068986 Ga0081539_100689862 294
39 3300006914 Ga0075436_100107232 Ga0075436_1001072322 294
40 3300006931 Ga0097620_100238634 Ga0097620_1002386342 294
41 3300007076 Ga0075435_100139425 Ga0075435_1001394252 294
42 3300009553 Ga0105249_10023004 Ga0105249_100230043 294
43 3300009553 Ga0105249_10424700 Ga0105249_104247002 294
44 3300011119 Ga0105246_10004493 Ga0105246_100044936 294
45 3300025908 Ga0207643_10061142 Ga0207643_100611423 294
46 3300025936 Ga0207670_10207511 Ga0207670_102075112 294
47 3300026116 Ga0207674_10608933 Ga0207674_106089331 294
48 3300031728 Ga0316578_10218055 Ga0316578_102180552 294
49 3300031733 Ga0316577_10047780 Ga0316577_100477802 294
50 3300035398 Ga0316574_0322723 Ga0316574_0322723_20_904 294
51 3300036712 Ga0316584_0142250 Ga0316584_0142250_404_1288 294
52 3300036712 Ga0316584_0283017 Ga0316584_0283017_44_928 294
53 3300044673 Ga0453683_0104356 Ga0453683_0104356_864_1751 294
54 3300044673 Ga0453683_0210775 Ga0453683_0210775_32_919 294
55 3300044712 Ga0453684_0000420 Ga0453684_0000420_137358_138242 294
56 3300044712 Ga0453684_0006953 Ga0453684_0006953_5160_6044 294
57 3300044712 Ga0453684_0038619 Ga0453684_0038619_615_1502 294
58 3300044712 Ga0453684_0040018 Ga0453684_0040018_4047_4934 294
59 3300044712 Ga0453684_0077402 Ga0453684_0077402_2811_3779 294
60 3300044712 Ga0453684_0096171 Ga0453684_0096171_2331_3215 294
61 3300044712 Ga0453684_0103702 Ga0453684_0103702_391_1359 294
62 3300044712 Ga0453684_0125516 Ga0453684_0125516_337_1221 294
63 3300044712 Ga0453684_0232579 Ga0453684_0232579_729_1613 294
64 3300044712 Ga0453684_0309661 Ga0453684_0309661_781_1749 294
65 3300044712 Ga0453684_0425450 Ga0453684_0425450_570_1466 294
66 3300044712 Ga0453684_0454316 Ga0453684_0454316_497_1381 294
67 3300045051 Ga0451576_0016413 Ga0451576_0016413_3071_3961 294
68 3300045051 Ga0451576_0057327 Ga0451576_0057327_2796_3683 294
69 3300045051 Ga0451576_0283809 Ga0451576_0283809_731_1615 294
70 3300049592 Ga0501076_0039623 Ga0501076_0039623_210_1100 294
71 3300050513 nmdc:mga0rr50_133833_c1 nmdc:mga0rr50_133833_c1_628_1524 294
72 3300044712 Ga0453684_0097957 Ga0453684_0097957_1428_2315 295
73 3300044712 Ga0453684_0164207 Ga0453684_0164207_591_1481 295
74 3300045051 Ga0451576_0011036 Ga0451576_0011036_9242_10129 295
75 3300005544 Ga0070686_100186949 Ga0070686_1001869491 296
76 3300005617 Ga0068859_100170073 Ga0068859_1001700732 296
77 3300006931 Ga0097620_100170074 Ga0097620_1001700742 296
78 3300009147 Ga0114129_10057624 Ga0114129_100576243 296
79 3300009147 Ga0114129_10423592 Ga0114129_104235922 296
80 3300031691 Ga0316579_10002425 Ga0316579_100024253 296
81 3300042876 Ga0451577_0008338 Ga0451577_0008338_7652_8542 296
82 3300044712 Ga0453684_0000024 Ga0453684_0000024_208470_209360 296
83 3300044712 Ga0453684_0638512 Ga0453684_0638512_133_1023 296
84 3300049578 Ga0501042_0167598 Ga0501042_0167598_618_1538 296
85 3300049591 Ga0501075_0060755 Ga0501075_0060755_1017_1937 296
86 3300049592 Ga0501076_0017107 Ga0501076_0017107_906_1826 296
87 3300049741 Ga0501079_0044577 Ga0501079_0044577_2436_3356 296
88 3300049742 Ga0501080_0045992 Ga0501080_0045992_1684_2604 296
89 3300049743 Ga0501081_0060934 Ga0501081_0060934_395_1315 296
90 3300054114 Ga0501084_0351959 Ga0501084_0351959_336_1226 296
91 3300060353 Ga0501082_0033409 Ga0501082_0033409_2295_3215 296
92 3300044712 Ga0453684_0322428 Ga0453684_0322428_82_975 297
93 3300036647 Ga0316582_0362097 Ga0316582_0362097_25_924 298
94 3300031995 Ga0307409_100412962 Ga0307409_1004129622 299
95 3300031727 Ga0316576_10195505 Ga0316576_101955052 300
96 3300036647 Ga0316582_0026814 Ga0316582_0026814_2045_2947 300
97 3300036712 Ga0316584_0036861 Ga0316584_0036861_2638_3540 300
98 3300036712 Ga0316584_0298485 Ga0316584_0298485_19_1071 300
99 3300005545 Ga0070695_100005519 Ga0070695_1000055193 301
100 3300025933 Ga0207706_10081910 Ga0207706_100819103 301
101 3300031728 Ga0316578_10111790 Ga0316578_101117902 301
102 3300005518 Ga0070699_100116799 Ga0070699_1001167993 302
103 3300006844 Ga0075428_100123302 Ga0075428_1001233022 302
104 3300006846 Ga0075430_100042328 Ga0075430_1000423282 302
105 3300006847 Ga0075431_100113140 Ga0075431_1001131404 302
106 3300006880 Ga0075429_100011076 Ga0075429_1000110766 302
107 3300006880 Ga0075429_100047044 Ga0075429_1000470442 302
108 3300009147 Ga0114129_10001679 Ga0114129_100016792 302
109 3300009147 Ga0114129_10407777 Ga0114129_104077773 302
110 3300009147 Ga0114129_11097609 Ga0114129_110976091 302
111 3300009553 Ga0105249_10166380 Ga0105249_101663802 302
112 3300025935 Ga0207709_10283727 Ga0207709_102837272 302
113 3300025961 Ga0207712_10182449 Ga0207712_101824492 302
114 3300044712 Ga0453684_0050773 Ga0453684_0050773_2404_3315 302
115 3300044712 Ga0453684_0209741 Ga0453684_0209741_91_1005 302
116 3300045051 Ga0451576_0062649 Ga0451576_0062649_588_1502 302
117 3300050507 nmdc:mga05p37_278289_c1 nmdc:mga05p37_278289_c1_867_1778 302
118 3300050507 nmdc:mga05p37_75303_c1 nmdc:mga05p37_75303_c1_736_1644 302
119 3300050507 nmdc:mga05p37_836591_c1 nmdc:mga05p37_836591_c1_56_964 302
120 3300050510 nmdc:mga06r32_579911_c1 nmdc:mga06r32_579911_c1_162_1073 302
121 2162886006 SwRhRL3b_contig_2229080 SwRhRL3b_0245.00000690 305
122 2162886007 SwRhRL2b_contig_713755 SwRhRL2b_0470.00000840 305
123 3300005289 Ga0065704_10100002 Ga0065704_101000022 305
124 3300005295 Ga0065707_10000492 Ga0065707_1000049241 305
125 3300005295 Ga0065707_10091817 Ga0065707_100918172 305
126 3300005353 Ga0070669_100000592 Ga0070669_10000059223 305
127 3300005467 Ga0070706_100109525 Ga0070706_1001095252 305
128 3300005985 Ga0081539_10002559 Ga0081539_1000255920 305
129 3300006847 Ga0075431_100039160 Ga0075431_1000391603 305
130 3300009094 Ga0111539_10465971 Ga0111539_104659711 305
131 3300009148 Ga0105243_10038703 Ga0105243_100387032 305
132 3300025910 Ga0207684_10100063 Ga0207684_101000633 305
133 3300025923 Ga0207681_10000021 Ga0207681_10000021133 305
134 3300028577 Ga0265318_10001994 Ga0265318_100019945 305
135 3300028800 Ga0265338_10013287 Ga0265338_100132878 305
136 3300031344 Ga0265316_10084298 Ga0265316_100842984 305
137 3300031731 Ga0307405_10118425 Ga0307405_101184252 305
138 3300031852 Ga0307410_10187775 Ga0307410_101877752 305
139 3300031903 Ga0307407_10173000 Ga0307407_101730001 305
140 3300050509 nmdc:mga0qj67_51261_c1 nmdc:mga0qj67_51261_c1_299_1240 305
141 3300050515 nmdc:mga0a205_31475_c1 nmdc:mga0a205_31475_c1_4097_5020 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

22

156

0.97

PF00892

EamA

EamA-like transporter family

170

312

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b0k-assembly1.cif.gz_A membrane protein structure 0.822 11 291
5i20-assembly1.cif.gz_A crystal structure of protein 0.8151 8 292
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.8102 11 291
5i20-assembly2.cif.gz_B crystal structure of protein 0.8101 8 292
7b0k-assembly1.cif.gz_A membrane protein structure 0.8048 11 291
ID Description Score Start End Superfamily
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7594 1 299 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7437 1 299 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7434 13 291 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7116 7 290 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6909 7 291 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A7X9EZR4-F1-model_v4 DMT family transporter 0.9662 1 299 GO:0016020
AF-A0A3N5HXQ7-F1-model_v4 EamA family transporter 0.9626 1 230 GO:0016020
AF-A0A6M0QB94-F1-model_v4 DMT family transporter 0.9584 1 292 GO:0005886
AF-A0A1U7J0I6-F1-model_v4 EamA family transporter 0.95 7 291 GO:0016020
AF-A0A2N6GHY8-F1-model_v4 EamA family transporter 0.9497 8 293 GO:0016020

Feature Viewer

pLDDT pTM Quality
90.04 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map