F180345

General Info

Members Datasets Scaffolds Average Seq Length
140 71 280 137

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0242178|Ga0466966_0242178_322_786
Length 154
Sequence MERVIKIDSVRTFETRGGNVRYVVRDSEGDEYTTFREAIGAKATECEGQRVRIEYHEGQRGQYTNVYLDKVEPIPAEAPGGDSSDTDPEEAAWRTAVEAAPWLVGESDPHAKTSPEELYETLKPFKDRVAEDIKEGVGESGEAPGADDPPPSAA

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
4 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
6 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
7 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
8 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
9 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
10 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
11 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
13 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
14 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
16 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
17 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
18 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
19 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
20 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
21 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
22 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
23 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
24 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
25 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
26 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
27 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
28 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
29 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
32 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
33 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
34 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
35 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
36 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
37 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
38 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
39 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
40 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
41 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
42 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
43 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
48 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
49 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
50 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
52 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
58 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
59 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
60 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
61 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
62 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
63 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
64 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
65 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
66 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
67 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
68 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
69 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
70 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
71 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 81.43
Stem 0
Stem Tuber 0
Unclassified 26.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0242178 3300044684 Bacteria 1087
2 JGI25407J50210_10043861 3300003373 Unclassified 1142
3 Ga0070700_100362472 3300005441 Bacteria 1078
4 Ga0081538_10000137 3300005981 Bacteria 75608
5 Ga0081538_10000781 3300005981 Bacteria 34721
6 Ga0081538_10002384 3300005981 Bacteria 18451
7 Ga0075432_10033367 3300006058 Bacteria 1786
8 Ga0075428_100026199 3300006844 Bacteria 6456
9 Ga0075428_100106342 3300006844 Bacteria 3059
10 Ga0075428_101131045 3300006844 Unclassified 827
11 Ga0075430_100005678 3300006846 Bacteria 10532
12 Ga0075431_100529864 3300006847 Bacteria 1167
13 Ga0075433_10036247 3300006852 Bacteria 4248
14 Ga0111539_10013263 3300009094 Bacteria 10302
15 Ga0114129_10008187 3300009147 Bacteria 14900
16 Ga0114129_10184827 3300009147 Bacteria 2834
17 Ga0114129_12468019 3300009147 Unclassified 622
18 Ga0213876_10006203 3300021384 Bacteria 6525
19 Ga0213876_10031946 3300021384 Bacteria 2777
20 Ga0213876_10036877 3300021384 Bacteria 2579
21 Ga0213876_10045895 3300021384 Bacteria 2310
22 Ga0213876_10153469 3300021384 Unclassified 1225
23 Ga0213875_10068977 3300021388 Bacteria 1651
24 Ga0213875_10122279 3300021388 Bacteria 1216
25 Ga0213875_10137458 3300021388 Unclassified 1143
26 Ga0213875_10467739 3300021388 Bacteria 604
27 Ga0207708_10375869 3300026075 Unclassified 1171
28 Ga0207428_10019604 3300027907 Bacteria 5764
29 Ga0307405_10276927 3300031731 Bacteria 1261
30 Ga0307405_10472442 3300031731 Unclassified 999
31 Ga0307405_10638132 3300031731 Bacteria 874
32 Ga0307406_10606241 3300031901 Bacteria 903
33 Ga0307412_10751174 3300031911 Bacteria 842
34 Ga0307409_100621555 3300031995 Bacteria 1070
35 Ga0307416_100005734 3300032002 Bacteria 7686
36 Ga0307416_100052253 3300032002 Unclassified 3271
37 Ga0307416_100147523 3300032002 Bacteria 2151
38 Ga0307416_102520538 3300032002 Bacteria 613
39 Ga0307416_102913759 3300032002 Bacteria 572
40 Ga0307414_10628103 3300032004 Unclassified 966
41 Ga0307411_10549384 3300032005 Bacteria 985
42 Ga0307415_100225262 3300032126 Unclassified 1506
43 Ga0307415_100346547 3300032126 Unclassified 1249
44 Ga0307415_100482535 3300032126 Bacteria 1079
45 Ga0373940_0127082 3300035088 Bacteria 796
46 Ga0373960_0033234 3300035121 Bacteria 1453
47 Ga0373962_0024867 3300035242 Bacteria 1605
48 Ga0373931_0094288 3300035691 Unclassified 1673
49 Ga0395905_1105199 3300037471 Bacteria 696
50 Ga0436364_0004733 3300037853 Unclassified 1495
51 Ga0436364_0036150 3300037853 Bacteria 780
52 Ga0436364_0353057 3300037853 Bacteria 4214
53 Ga0436364_0557675 3300037853 Bacteria 20536
54 Ga0436364_0595035 3300037853 Bacteria 3384
55 Ga0436364_0976762 3300037853 Unclassified 2476
56 Ga0436364_1340811 3300037853 Bacteria 4417
57 Ga0395901_0313264 3300038443 Bacteria 1625
58 Ga0395901_0582084 3300038443 Bacteria 1131
59 Ga0436365_0080199 3300039437 Unclassified 1324
60 Ga0436365_0216322 3300039437 Bacteria 9046
61 Ga0436365_0252188 3300039437 Bacteria 11796
62 Ga0436365_0413410 3300039437 Bacteria 8316
63 Ga0436365_0869687 3300039437 Bacteria 5463
64 Ga0436365_1208184 3300039437 Bacteria 19667
65 Ga0436363_0503413 3300039450 Bacteria 1036
66 Ga0436363_0954345 3300039450 Bacteria 2562
67 Ga0436363_0992482 3300039450 Bacteria 1020
68 Ga0436363_1557234 3300039450 Bacteria 3071
69 Ga0436362_0011493 3300039453 Bacteria 4966
70 Ga0436362_0202220 3300039453 Bacteria 1460
71 Ga0450888_064325 3300042126 Unclassified 543
72 Ga0439458_0141269 3300042157 Unclassified 642
73 Ga0466969_0229204 3300044656 Unclassified 844
74 Ga0466969_0420496 3300044656 Unclassified 607
75 Ga0466965_0442994 3300044683 Bacteria 722
76 Ga0466966_0029442 3300044684 Bacteria 3573
77 Ga0466966_0351336 3300044684 Unclassified 886
78 Ga0466961_0031863 3300044693 Bacteria 3388
79 Ga0466961_0531035 3300044693 Bacteria 709
80 Ga0466963_0046000 3300044694 Bacteria 2876
81 Ga0466963_0233936 3300044694 Unclassified 1288
82 Ga0466963_0687618 3300044694 Unclassified 722
83 Ga0466963_1345850 3300044694 Bacteria 501
84 Ga0466971_0012384 3300044719 Bacteria 3737
85 Ga0466971_0036348 3300044719 Bacteria 2209
86 Ga0466971_0192653 3300044719 Bacteria 961
87 Ga0466971_0211081 3300044719 Bacteria 918
88 Ga0466968_0008709 3300044735 Bacteria 3890
89 Ga0466968_0148889 3300044735 Unclassified 1075
90 Ga0466968_0665627 3300044735 Unclassified 529
91 Ga0466957_0071418 3300044842 Unclassified 2147
92 Ga0466957_0098160 3300044842 Bacteria 1843
93 Ga0466960_0071048 3300044901 Bacteria 1733
94 Ga0466959_0069914 3300045049 Bacteria 2543
95 Ga0466959_0104522 3300045049 Bacteria 2026
96 Ga0466959_0200083 3300045049 Bacteria 1391
97 Ga0466959_0245682 3300045049 Bacteria 1235
98 Ga0466958_0003331 3300045836 Bacteria 8322
99 Ga0466958_0020840 3300045836 Bacteria 3826
100 Ga0466958_0023653 3300045836 Bacteria 3609
101 Ga0466958_0049196 3300045836 Bacteria 2550
102 Ga0466958_0294983 3300045836 Unclassified 1040
103 Ga0466958_0739224 3300045836 Unclassified 641
104 Ga0466958_1111684 3300045836 Bacteria 516
105 Ga0466967_0091968 3300045976 Unclassified 2758
106 Ga0466967_0254578 3300045976 Bacteria 1678
107 Ga0466967_0311344 3300045976 Bacteria 1517
108 Ga0466967_0659890 3300045976 Unclassified 1035
109 Ga0466967_1628025 3300045976 Unclassified 643
110 Ga0495584_0539877 3300046491 Bacteria 594
111 Ga0495668_0351713 3300046616 Unclassified 809
112 Ga0495589_0127893 3300046794 Bacteria 1221
113 Ga0501031_0166086 3300049568 Bacteria 1443
114 Ga0501033_0189579 3300049570 Bacteria 1472
115 Ga0501036_0077748 3300049572 Bacteria 2808
116 Ga0501039_0411715 3300049575 Bacteria 1062
117 Ga0501040_0032001 3300049576 Bacteria 3558
118 Ga0501040_0528391 3300049576 Unclassified 851
119 Ga0501041_0039695 3300049577 Bacteria 2857
120 Ga0501046_0342020 3300049580 Archaea 1087
121 Ga0501046_0372975 3300049580 Unclassified 1034
122 Ga0501071_0279052 3300049587 Bacteria 1264
123 Ga0501071_0624601 3300049587 Unclassified 829
124 Ga0501071_0691095 3300049587 Unclassified 785
125 Ga0501072_0101246 3300049588 Bacteria 2290
126 Ga0501075_0046587 3300049591 Bacteria 3257
127 Ga0501076_0070955 3300049592 Bacteria 2786
128 Ga0501076_0115700 3300049592 Bacteria 2170
129 Ga0501077_0422865 3300049593 Bacteria 852
130 Ga0501079_0017531 3300049741 Bacteria 5469
131 Ga0501079_0339303 3300049741 Bacteria 1177
132 Ga0501045_0061091 3300049824 Bacteria 2764
133 nmdc:mga05p37_47289_c1 3300050507 Unclassified 982
134 nmdc:mga09592_29792_c1 3300050508 Bacteria 4539
135 nmdc:mga0qj67_68671_c1 3300050509 Bacteria 2825
136 nmdc:mga06r32_579707_c1 3300050510 Bacteria 1094
137 nmdc:mga08y16_12522_c1 3300050511 Bacteria 8923
138 nmdc:mga08x19_909352_c1 3300050514 Unclassified 625
139 Ga0466962_0252099 3300061719 Bacteria 867
140 Ga0530510_0061846 3300061734 Bacteria 2711
141 Ga0466966_0242178
142 JGI25407J50210_10043861
143 Ga0070700_100362472
144 Ga0081538_10000137
145 Ga0081538_10000781
146 Ga0081538_10002384
147 Ga0075432_10033367
148 Ga0075428_100026199
149 Ga0075428_100106342
150 Ga0075428_101131045
151 Ga0075430_100005678
152 Ga0075431_100529864
153 Ga0075433_10036247
154 Ga0111539_10013263
155 Ga0114129_10008187
156 Ga0114129_10184827
157 Ga0114129_12468019
158 Ga0213876_10006203
159 Ga0213876_10031946
160 Ga0213876_10036877
161 Ga0213876_10045895
162 Ga0213876_10153469
163 Ga0213875_10068977
164 Ga0213875_10122279
165 Ga0213875_10137458
166 Ga0213875_10467739
167 Ga0207708_10375869
168 Ga0207428_10019604
169 Ga0307405_10276927
170 Ga0307405_10472442
171 Ga0307405_10638132
172 Ga0307406_10606241
173 Ga0307412_10751174
174 Ga0307409_100621555
175 Ga0307416_100005734
176 Ga0307416_100052253
177 Ga0307416_100147523
178 Ga0307416_102520538
179 Ga0307416_102913759
180 Ga0307414_10628103
181 Ga0307411_10549384
182 Ga0307415_100225262
183 Ga0307415_100346547
184 Ga0307415_100482535
185 Ga0373940_0127082
186 Ga0373960_0033234
187 Ga0373962_0024867
188 Ga0373931_0094288
189 Ga0395905_1105199
190 Ga0436364_0004733
191 Ga0436364_0036150
192 Ga0436364_0353057
193 Ga0436364_0557675
194 Ga0436364_0595035
195 Ga0436364_0976762
196 Ga0436364_1340811
197 Ga0395901_0313264
198 Ga0395901_0582084
199 Ga0436365_0080199
200 Ga0436365_0216322
201 Ga0436365_0252188
202 Ga0436365_0413410
203 Ga0436365_0869687
204 Ga0436365_1208184
205 Ga0436363_0503413
206 Ga0436363_0954345
207 Ga0436363_0992482
208 Ga0436363_1557234
209 Ga0436362_0011493
210 Ga0436362_0202220
211 Ga0450888_064325
212 Ga0439458_0141269
213 Ga0466969_0229204
214 Ga0466969_0420496
215 Ga0466965_0442994
216 Ga0466966_0029442
217 Ga0466966_0351336
218 Ga0466961_0031863
219 Ga0466961_0531035
220 Ga0466963_0046000
221 Ga0466963_0233936
222 Ga0466963_0687618
223 Ga0466963_1345850
224 Ga0466971_0012384
225 Ga0466971_0036348
226 Ga0466971_0192653
227 Ga0466971_0211081
228 Ga0466968_0008709
229 Ga0466968_0148889
230 Ga0466968_0665627
231 Ga0466957_0071418
232 Ga0466957_0098160
233 Ga0466960_0071048
234 Ga0466959_0069914
235 Ga0466959_0104522
236 Ga0466959_0200083
237 Ga0466959_0245682
238 Ga0466958_0003331
239 Ga0466958_0020840
240 Ga0466958_0023653
241 Ga0466958_0049196
242 Ga0466958_0294983
243 Ga0466958_0739224
244 Ga0466958_1111684
245 Ga0466967_0091968
246 Ga0466967_0254578
247 Ga0466967_0311344
248 Ga0466967_0659890
249 Ga0466967_1628025
250 Ga0495584_0539877
251 Ga0495668_0351713
252 Ga0495589_0127893
253 Ga0501031_0166086
254 Ga0501033_0189579
255 Ga0501036_0077748
256 Ga0501039_0411715
257 Ga0501040_0032001
258 Ga0501040_0528391
259 Ga0501041_0039695
260 Ga0501046_0342020
261 Ga0501046_0372975
262 Ga0501071_0279052
263 Ga0501071_0624601
264 Ga0501071_0691095
265 Ga0501072_0101246
266 Ga0501075_0046587
267 Ga0501076_0070955
268 Ga0501076_0115700
269 Ga0501077_0422865
270 Ga0501079_0017531
271 Ga0501079_0339303
272 Ga0501045_0061091
273 nmdc:mga05p37_47289_c1
274 nmdc:mga09592_29792_c1
275 nmdc:mga0qj67_68671_c1
276 nmdc:mga06r32_579707_c1
277 nmdc:mga08y16_12522_c1
278 nmdc:mga08x19_909352_c1
279 Ga0466962_0252099
280 Ga0530510_0061846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6thl-assembly1.cif.gz_A crystal structure of the complex between rtt106 and bcd1 0.8608 7 33
4gir-assembly1.cif.gz_D-2 crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group p41212) 0.8592 5 33
3rr1-assembly1.cif.gz_B crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j 0.8591 3 33
4il2-assembly2.cif.gz_C crystal structure of d-mannonate dehydratase (rspa) from e. coli cft073 (efi target efi-501585) 0.8484 6 33
2vdu-assembly2.cif.gz_B structure of trm8-trm82, the yeast trna m7g methylation complex 0.8465 5 37
ID Description Score Start End Superfamily
af_Q54LX4_3_401_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8916 5 34 3.50.50.60
af_F1QLM2_10_130_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8671 10 33 2.102.10.10
af_F1RB34_7_278_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8562 7 38 2.130.10.10
af_P38104_1_104_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.8552 6 33 3.30.390.10
af_F1M5N7_1252_1481_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.838 9 34 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A831QRQ9-F1-model_v4 Uncharacterized protein 0.8633 1 75
AF-A0A0F9EAZ1-F1-model_v4 Phage recombination protein Bet 0.8476 1 78 GO:0003677
GO:0006259
AF-A0A1V5YEC3-F1-model_v4 RecT family protein 0.8311 2 76 GO:0003677
GO:0006259
AF-A0A449BDK7-F1-model_v4 DNA-directed DNA polymerase (EC 2.7.7.7) 0.8291 1 77 GO:0003887
GO:0006260
GO:0008408
AF-A0A4R6DMT2-F1-model_v4 Uncharacterized protein 0.816 1 74 GO:0016020

Map