F178872

General Info

Members Datasets Scaffolds Average Seq Length
140 115 131 291

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100114147|Ga0070679_1001141473
Length 311
Sequence MTGARTCGEGWSIIEDMKRRGTAWLGLLLVTSLAASRAEAAAQPDGVDSTLLKVCADAHNLPQSNDKGEGYENEIAQALARDLKRKVVYTWFPQRMGFVRNTLRAVDETTHQYKCDVIIGVPKGYELTATTQPYMRSTYAFIAPASDDFRKLKHADEVLKLPAQKLHSLRIGIFAQTPAADWLLKNGLLDHASLYAAQSGDPQENPQSVVGSELGAAKIDAAIVWGPVAGYLVSRHQASGSGTPWVELPFKPDPAIKFDYEMAMGVRQADKEWKNTLDGWIASHQSEINKILAAHNVPLLDAQGEIISAKN

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221660 Methylibium sp. Root1272 Isolate Unclassified
9 2738543013 Variovorax sp. BT01 Isolate Unclassified
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
36 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
73 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
74 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
75 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
76 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
77 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
96 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
97 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
102 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
103 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
104 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
105 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
106 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
107 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
108 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
109 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
110 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
111 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
112 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
113 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
114 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
115 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.14
Metatranscriptomes 1.43
Isolates 6.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.57
Nodule 0
Rhizoplane 4.29
Rhizosphere 50.71
Stem 0
Stem Tuber 0
Unclassified 16.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002097 3300003215 Bacteria 11710
2 rootL2_10015223 3300003322 Bacteria 4408
3 Ga0055534_1001347 3300003784 Bacteria 9868
4 Ga0055530_10012377 3300003791 Bacteria 2982
5 Ga0065165_1000793 3300005262 Bacteria 42189
6 Ga0070677_10036657 3300005333 Bacteria 1909
7 Ga0070680_100079010 3300005336 Bacteria 2711
8 Ga0070708_100140894 3300005445 Bacteria 2236
9 Ga0070708_100476106 3300005445 Bacteria 1178
10 Ga0070681_10059597 3300005458 Bacteria 3797
11 Ga0070681_10178752 3300005458 Bacteria 2043
12 Ga0070679_100114147 3300005530 Bacteria 2687
13 Ga0068855_100095064 3300005563 Bacteria 3435
14 Ga0068861_100596525 3300005719 Bacteria 1013
15 Ga0068862_100124224 3300005844 Bacteria 2277
16 Ga0075365_10031119 3300006038 Bacteria 3421
17 Ga0075362_10032949 3300006177 Bacteria 2251
18 Ga0075366_10000309 3300006195 Bacteria 22109
19 Ga0075366_10008669 3300006195 Bacteria 5662
20 Ga0075366_10165366 3300006195 Bacteria 1341
21 Ga0075370_10053328 3300006353 Bacteria 2295
22 Ga0075430_100110590 3300006846 Bacteria 2291
23 Ga0075429_100004808 3300006880 Bacteria 11629
24 Ga0105240_10284432 3300009093 Bacteria 1898
25 Ga0105238_10038100 3300009551 Bacteria 4884
26 Ga0157372_10078441 3300013307 Bacteria 3732
27 Ga0163163_10755069 3300014325 Bacteria 1036
28 Ga0206350_10623858 3300020080 Bacteria 1550
29 Ga0224712_10011384 3300022467 Bacteria 2759
30 Ga0209129_1009914 3300025258 Bacteria 2441
31 Ga0209673_1011695 3300025273 Bacteria 3598
32 Ga0209758_1000078 3300025297 Bacteria 266153
33 Ga0209050_1000335 3300025298 Bacteria 93521
34 Ga0209051_1022497 3300025303 Bacteria 2652
35 Ga0209051_1051100 3300025303 Bacteria 1378
36 Ga0209257_1010873 3300025304 Bacteria 4501
37 Ga0207682_10038644 3300025893 Bacteria 1937
38 Ga0207707_10037736 3300025912 Bacteria 4221
39 Ga0207695_10163438 3300025913 Bacteria 2156
40 Ga0207660_10008698 3300025917 Bacteria 6565
41 Ga0207652_10083280 3300025921 Bacteria 2801
42 Ga0207691_10026145 3300025940 Bacteria 5477
43 Ga0207667_10304447 3300025949 Bacteria 1628
44 Ga0207648_10042366 3300026089 Bacteria 3996
45 Ga0207683_10065909 3300026121 Bacteria 3193
46 Ga0209996_1001654 3300027395 Bacteria 2714
47 Ga0209968_1000268 3300027526 Bacteria 8935
48 Ga0209966_1000509 3300027695 Bacteria 10127
49 Ga0268265_10082166 3300028380 Bacteria 2547
50 Ga0268265_10099693 3300028380 Bacteria 2342
51 Ga0307517_10156406 3300028786 Bacteria 1545
52 Ga0307515_10000240 3300028794 Bacteria 135655
53 Ga0307515_10000477 3300028794 Bacteria 95378
54 Ga0307515_10002198 3300028794 Bacteria 42799
55 Ga0307515_10015073 3300028794 Bacteria 14275
56 Ga0307515_10097922 3300028794 Bacteria 3578
57 Ga0307512_10044969 3300030522 Bacteria 3623
58 Ga0307513_10024847 3300031456 Bacteria 6962
59 Ga0307513_10179536 3300031456 Bacteria 1982
60 Ga0307509_10032943 3300031507 Bacteria 5707
61 Ga0307509_10150048 3300031507 Bacteria 2249
62 Ga0307408_100066815 3300031548 Bacteria 2642
63 Ga0307408_100320274 3300031548 Bacteria 1306
64 Ga0307508_10001797 3300031616 Bacteria 23788
65 Ga0307514_10013193 3300031649 Bacteria 6857
66 Ga0316579_10170961 3300031691 Bacteria 1051
67 Ga0307516_10002530 3300031730 Bacteria 24357
68 Ga0307516_10019215 3300031730 Bacteria 7080
69 Ga0307413_10142380 3300031824 Bacteria 1659
70 Ga0307412_10025599 3300031911 Bacteria 3656
71 Ga0307409_100036924 3300031995 Bacteria 3597
72 Ga0307414_10008269 3300032004 Bacteria 5889
73 Ga0307414_10174588 3300032004 Bacteria 1722
74 Ga0307507_10029229 3300033179 Bacteria 5850
75 Ga0316574_0033579 3300035398 Bacteria 3123
76 Ga0373937_0246228 3300036401 Bacteria 1685
77 Ga0373937_0331655 3300036401 Bacteria 1440
78 Ga0395905_0013796 3300037471 Bacteria 7732
79 Ga0439465_0103964 3300041413 Bacteria 983
80 Ga0451791_1148461 3300041451 Bacteria 1571
81 Ga0451793_0089896 3300041452 Bacteria 1826
82 Ga0451800_0444623 3300041459 Bacteria 3125
83 Ga0451802_1815608 3300041460 Bacteria 1129
84 Ga0451851_0661600 3300041507 Bacteria 2017
85 Ga0453684_0580943 3300044712 Bacteria 1231
86 Ga0466968_0009136 3300044735 Bacteria 3809
87 Ga0495641_0064373 3300046461 Bacteria 1652
88 Ga0495650_0018225 3300046471 Bacteria 3494
89 Ga0495650_0041451 3300046471 Bacteria 1968
90 Ga0495610_0037616 3300046512 Bacteria 2461
91 Ga0495620_0072522 3300046515 Bacteria 1406
92 Ga0495632_0006367 3300046519 Bacteria 7611
93 Ga0495632_0039532 3300046519 Bacteria 2380
94 Ga0495598_0004470 3300046537 Bacteria 3030
95 Ga0495656_0000059 3300046615 Bacteria 52745
96 Ga0495625_0000666 3300046660 Bacteria 48953
97 Ga0495658_0243312 3300046683 Bacteria 1130
98 Ga0495660_0035772 3300046810 Bacteria 2773
99 Ga0495672_0000198 3300047320 Bacteria 85895
100 Ga0495683_0060387 3300047323 Bacteria 1879
101 Ga0495686_0047472 3300047472 Bacteria 2711
102 Ga0496102_0017715 3300048905 Bacteria 6244
103 Ga0496115_0141658 3300048918 Bacteria 1984
104 Ga0495678_002286 3300049459 Bacteria 13289
105 Ga0495678_010354 3300049459 Bacteria 4539
106 nmdc:mga03683_80467_c1 3300050489 Bacteria 1406
107 nmdc:mga0k408_11553_c1 3300050493 Bacteria 4813
108 nmdc:mga0k408_140771_c1 3300050493 Bacteria 1435
109 nmdc:mga0k408_25175_c1 3300050493 Bacteria 3369
110 nmdc:mga0k408_6169_c1 3300050493 Bacteria 6391
111 nmdc:mga0k408_79671_c1 3300050493 Bacteria 1917
112 nmdc:mga07m45_31486_c1 3300050496 Bacteria 2940
113 nmdc:mga07m45_45865_c1 3300050496 Bacteria 2454
114 nmdc:mga09592_917_c1 3300050508 Bacteria 23179
115 nmdc:mga0qj67_46680_c1 3300050509 Bacteria 3420
116 nmdc:mga0sz30_55693_c1 3300050516 Bacteria 1683
117 Ga0500578_0000067 3300053086 Bacteria 115659
118 Ga0500644_0017973 3300053088 Bacteria 2063
119 Ga0500651_0000511 3300053093 Bacteria 20008
120 Ga0500641_0004461 3300053096 Bacteria 4949
121 Ga0500557_053897 3300053105 Bacteria 1294
122 Ga0500642_0020117 3300053130 Bacteria 2617
123 Ga0500652_000271 3300053131 Bacteria 19395
124 Ga0500655_002587 3300053133 Bacteria 3288
125 Ga0500577_0009059 3300053142 Bacteria 2872
126 Ga0500604_0021341 3300053151 Bacteria 1830
127 Ga0500604_0026903 3300053151 Bacteria 1661
128 Ga0500622_0000424 3300053156 Bacteria 40033
129 Ga0500627_0133508 3300053158 Bacteria 1121
130 Ga0500587_000518 3300053739 Bacteria 4693
131 Ga0590075_010854 3300059424 Bacteria 2197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059424 Ga0590075_010854 Ga0590075_010854_939_1826 256
2 3300003322 rootL2_10015223 rootL2_100152237 260
3 3300026121 Ga0207683_10065909 Ga0207683_100659093 267
4 3300014325 Ga0163163_10755069 Ga0163163_107550692 271
5 3300025304 Ga0209257_1010873 Ga0209257_10108732 271
6 3300028794 Ga0307515_10000240 Ga0307515_1000024092 271
7 3300003784 Ga0055534_1001347 Ga0055534_10013473 273
8 3300025303 Ga0209051_1022497 Ga0209051_10224973 273
9 3300006353 Ga0075370_10053328 Ga0075370_100533283 274
10 3300048918 Ga0496115_0141658 Ga0496115_0141658_919_1794 274
11 3300049459 Ga0495678_010354 Ga0495678_010354_2362_3252 274
12 3300025917 Ga0207660_10008698 Ga0207660_100086984 275
13 3300047323 Ga0495683_0060387 Ga0495683_0060387_888_1718 275
14 3300037471 Ga0395905_0013796 Ga0395905_0013796_2472_3305 277
15 3300044735 Ga0466968_0009136 Ga0466968_0009136_2537_3400 277
16 3300049459 Ga0495678_002286 Ga0495678_002286_9526_10392 279
17 3300006195 Ga0075366_10165366 Ga0075366_101653662 281
18 3300028794 Ga0307515_10000477 Ga0307515_1000047771 281
19 3300030522 Ga0307512_10044969 Ga0307512_100449692 281
20 3300031824 Ga0307413_10142380 Ga0307413_101423802 281
21 3300050493 nmdc:mga0k408_140771_c1 nmdc:mga0k408_140771_c1_468_1316 281
22 3300050493 nmdc:mga0k408_6169_c1 nmdc:mga0k408_6169_c1_2615_3466 281
23 3300006195 Ga0075366_10008669 Ga0075366_100086697 282
24 3300026089 Ga0207648_10042366 Ga0207648_100423663 282
25 3300028380 Ga0268265_10082166 Ga0268265_100821663 282
26 3300031548 Ga0307408_100320274 Ga0307408_1003202741 282
27 3300031911 Ga0307412_10025599 Ga0307412_100255992 282
28 3300041413 Ga0439465_0103964 Ga0439465_0103964_50_910 282
29 3300041459 Ga0451800_0444623 Ga0451800_0444623_847_1731 282
30 3300041460 Ga0451802_1815608 Ga0451802_1815608_219_1103 282
31 3300050493 nmdc:mga0k408_25175_c1 nmdc:mga0k408_25175_c1_409_1260 282
32 3300053093 Ga0500651_0000511 Ga0500651_0000511_4765_5649 282
33 3300053133 Ga0500655_002587 Ga0500655_002587_644_1528 282
34 3300053142 Ga0500577_0009059 Ga0500577_0009059_168_1052 282
35 3300053151 Ga0500604_0026903 Ga0500604_0026903_675_1559 282
36 3300053156 Ga0500622_0000424 Ga0500622_0000424_27165_28049 282
37 3300028794 Ga0307515_10097922 Ga0307515_100979225 283
38 3300031456 Ga0307513_10024847 Ga0307513_100248473 283
39 3300044712 Ga0453684_0580943 Ga0453684_0580943_94_951 283
40 3300053086 Ga0500578_0000067 Ga0500578_0000067_75967_76821 283
41 3300005844 Ga0068862_100124224 Ga0068862_1001242242 284
42 3300027395 Ga0209996_1001654 Ga0209996_10016543 284
43 3300027526 Ga0209968_1000268 Ga0209968_10002687 284
44 3300027695 Ga0209966_1000509 Ga0209966_10005093 284
45 3300028380 Ga0268265_10099693 Ga0268265_100996932 284
46 3300050496 nmdc:mga07m45_31486_c1 nmdc:mga07m45_31486_c1_1399_2262 284
47 iso_pu_bacteria 2643221660 2644338047 284
48 iso_pu_bacteria 2738543013 2739248732 284
49 3300005336 Ga0070680_100079010 Ga0070680_1000790103 285
50 3300005445 Ga0070708_100140894 Ga0070708_1001408942 285
51 3300005445 Ga0070708_100476106 Ga0070708_1004761061 285
52 3300005458 Ga0070681_10059597 Ga0070681_100595973 285
53 3300005458 Ga0070681_10178752 Ga0070681_101787522 285
54 3300005530 Ga0070679_100114147 Ga0070679_1001141473 285
55 3300005563 Ga0068855_100095064 Ga0068855_1000950642 285
56 3300006038 Ga0075365_10031119 Ga0075365_100311192 285
57 3300006177 Ga0075362_10032949 Ga0075362_100329493 285
58 3300006195 Ga0075366_10000309 Ga0075366_100003093 285
59 3300009093 Ga0105240_10284432 Ga0105240_102844322 285
60 3300009551 Ga0105238_10038100 Ga0105238_100381003 285
61 3300013307 Ga0157372_10078441 Ga0157372_100784414 285
62 3300020080 Ga0206350_10623858 Ga0206350_106238582 285
63 3300022467 Ga0224712_10011384 Ga0224712_100113841 285
64 3300025912 Ga0207707_10037736 Ga0207707_100377363 285
65 3300025913 Ga0207695_10163438 Ga0207695_101634381 285
66 3300025921 Ga0207652_10083280 Ga0207652_100832803 285
67 3300025949 Ga0207667_10304447 Ga0207667_103044472 285
68 3300036401 Ga0373937_0331655 Ga0373937_0331655_221_1081 285
69 3300046471 Ga0495650_0018225 Ga0495650_0018225_83_943 285
70 3300050489 nmdc:mga03683_80467_c1 nmdc:mga03683_80467_c1_38_898 285
71 3300050493 nmdc:mga0k408_79671_c1 nmdc:mga0k408_79671_c1_295_1155 285
72 3300053088 Ga0500644_0017973 Ga0500644_0017973_431_1363 285
73 3300053096 Ga0500641_0004461 Ga0500641_0004461_785_1651 285
74 3300005333 Ga0070677_10036657 Ga0070677_100366573 286
75 3300005719 Ga0068861_100596525 Ga0068861_1005965251 286
76 3300006846 Ga0075430_100110590 Ga0075430_1001105902 286
77 3300006880 Ga0075429_100004808 Ga0075429_1000048083 286
78 3300025893 Ga0207682_10038644 Ga0207682_100386441 286
79 3300025940 Ga0207691_10026145 Ga0207691_100261455 286
80 3300031507 Ga0307509_10150048 Ga0307509_101500483 286
81 3300031548 Ga0307408_100066815 Ga0307408_1000668152 286
82 3300031691 Ga0316579_10170961 Ga0316579_101709611 286
83 3300031730 Ga0307516_10002530 Ga0307516_1000253017 286
84 3300031995 Ga0307409_100036924 Ga0307409_1000369242 286
85 3300035398 Ga0316574_0033579 Ga0316574_0033579_1776_2663 286
86 3300036401 Ga0373937_0246228 Ga0373937_0246228_345_1247 286
87 3300041451 Ga0451791_1148461 Ga0451791_1148461_273_1193 286
88 3300046461 Ga0495641_0064373 Ga0495641_0064373_676_1578 286
89 3300046471 Ga0495650_0041451 Ga0495650_0041451_375_1256 286
90 3300046537 Ga0495598_0004470 Ga0495598_0004470_182_1054 286
91 3300046615 Ga0495656_0000059 Ga0495656_0000059_21958_22827 286
92 3300046683 Ga0495658_0243312 Ga0495658_0243312_30_932 286
93 3300050508 nmdc:mga09592_917_c1 nmdc:mga09592_917_c1_13939_14814 286
94 3300050509 nmdc:mga0qj67_46680_c1 nmdc:mga0qj67_46680_c1_2307_3182 286
95 3300053158 Ga0500627_0133508 Ga0500627_0133508_196_1056 286
96 3300031456 Ga0307513_10179536 Ga0307513_101795362 287
97 3300032004 Ga0307414_10174588 Ga0307414_101745882 287
98 3300041452 Ga0451793_0089896 Ga0451793_0089896_886_1770 287
99 3300046515 Ga0495620_0072522 Ga0495620_0072522_156_1022 287
100 3300046519 Ga0495632_0039532 Ga0495632_0039532_253_1128 287
101 3300053130 Ga0500642_0020117 Ga0500642_0020117_1531_2406 287
102 3300053131 Ga0500652_000271 Ga0500652_000271_3391_4266 287
103 iso_pu_bacteria 2588253510 2588294241 287
104 3300046810 Ga0495660_0035772 Ga0495660_0035772_1120_2055 288
105 3300047320 Ga0495672_0000198 Ga0495672_0000198_77315_78241 288
106 3300003791 Ga0055530_10012377 Ga0055530_100123772 289
107 3300025298 Ga0209050_1000335 Ga0209050_100033569 289
108 3300025303 Ga0209051_1051100 Ga0209051_10511002 289
109 3300053105 Ga0500557_053897 Ga0500557_053897_32_907 290
110 3300053151 Ga0500604_0021341 Ga0500604_0021341_530_1405 290
111 iso_pu_bacteria 2585428062 2587758514 290
112 3300005262 Ga0065165_1000793 Ga0065165_10007938 291
113 3300025273 Ga0209673_1011695 Ga0209673_10116952 291
114 3300032004 Ga0307414_10008269 Ga0307414_100082693 291
115 iso_pu_bacteria 2585428057 2587727609 292
116 iso_pu_bacteria 2585428058 2587732965 292
117 iso_pu_bacteria 2643221592 2643968495 292
118 iso_pu_bacteria 2643221625 2644140713 292
119 iso_pu_bacteria 2643221648 2644272767 292
120 3300028794 Ga0307515_10015073 Ga0307515_1001507316 293
121 3300031730 Ga0307516_10019215 Ga0307516_100192157 293
122 3300041507 Ga0451851_0661600 Ga0451851_0661600_567_1508 293
123 3300046512 Ga0495610_0037616 Ga0495610_0037616_1047_1988 293
124 3300046519 Ga0495632_0006367 Ga0495632_0006367_1667_2608 293
125 3300046660 Ga0495625_0000666 Ga0495625_0000666_41904_42845 293
126 3300047472 Ga0495686_0047472 Ga0495686_0047472_1164_2105 293
127 3300048905 Ga0496102_0017715 Ga0496102_0017715_3696_4619 293
128 3300053739 Ga0500587_000518 Ga0500587_000518_3298_4239 293
129 3300003215 JGI25153J46596_10002097 JGI25153J46596_100020976 295
130 3300025258 Ga0209129_1009914 Ga0209129_10099142 295
131 3300025297 Ga0209758_1000078 Ga0209758_1000078245 295
132 3300028786 Ga0307517_10156406 Ga0307517_101564062 295
133 3300028794 Ga0307515_10002198 Ga0307515_1000219811 295
134 3300031507 Ga0307509_10032943 Ga0307509_100329433 295
135 3300031616 Ga0307508_10001797 Ga0307508_1000179712 295
136 3300031649 Ga0307514_10013193 Ga0307514_100131935 295
137 3300033179 Ga0307507_10029229 Ga0307507_100292296 295
138 3300050493 nmdc:mga0k408_11553_c1 nmdc:mga0k408_11553_c1_587_1489 295
139 3300050496 nmdc:mga07m45_45865_c1 nmdc:mga07m45_45865_c1_275_1177 295
140 3300050516 nmdc:mga0sz30_55693_c1 nmdc:mga0sz30_55693_c1_764_1666 295

Structural Annotation

Top 5 Hits

ID Description Score Start End
6onp-assembly1.cif.gz_A crystal structure of periplasmic binding protein xoxj from methylobacterium extorquens am1 0.9333 33 279
6onp-assembly1.cif.gz_A crystal structure of periplasmic binding protein xoxj from methylobacterium extorquens am1 0.929 33 279
5sv6-assembly1.cif.gz_A crystal structure of mxaj from methlophaga aminisulfidivorans mpt 0.8246 33 277
5sv6-assembly1.cif.gz_A crystal structure of mxaj from methlophaga aminisulfidivorans mpt 0.8183 33 277
1ggg-assembly1.cif.gz_B glutamine binding protein open ligand-free structure 0.7322 34 273
ID Description Score Start End Superfamily
2pyyC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7919 118 225 3.40.190.10
5l9mA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7852 120 225 3.40.190.10
5bwjB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7769 120 224 3.40.190.10
1iiwA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7675 120 225 3.40.190.10
5hmtA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7649 32 278 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1G8BWR4-F1-model_v4 Amino acid ABC transporter substrate-binding protein, PAAT family 0.9745 25 285 GO:0030313
AF-A0A1G8BWR4-F1-model_v4 Amino acid ABC transporter substrate-binding protein, PAAT family 0.9636 25 285 GO:0030313
AF-A0A2S5QBJ9-F1-model_v4 ABC transporter substrate-binding protein 0.9483 32 102
AF-A0A1Z9BDH7-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.9391 43 279 GO:0030313
AF-A0A537BRR2-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9369 150 280

Feature Viewer

pLDDT pTM Quality
87.77 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map