F177549

General Info

Members Datasets Scaffolds Average Seq Length
139 114 105 181

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0311971|Ga0496122_0311971_164_790
Length 208
Sequence MNSADRILFKNQPEIIEKEGKIGMKSKNDDVKIGKFLSLVLRHQPQAAGIKLDANGWASVDELIAGVNRSGRRLDRAALERIVAENNKKRYSFNEDRTKIRANQGHSLSVDVELKAQKPPELLYHGTARHLVPSIQLMGIKKGTRQHVHLTDDPALALKVGTRHGMPVSLEIEAGAMHELGHVFYKSENDVWLVEFVPSVFVKERGDL

Samples

Sample ID Description Type Environment
1 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
2 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
3 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
4 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
5 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
6 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
7 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
8 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
9 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
10 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
11 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
12 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
13 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
14 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
15 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
16 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
17 2738541278 Niastella sp. CF465 Isolate Unclassified
18 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
19 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
20 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
21 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
22 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
23 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
24 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
25 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
26 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
27 2818991444 Filimonas endophytica 3197 Isolate Unclassified
28 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
29 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
30 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
31 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
32 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
33 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
69 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
70 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
71 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
72 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
73 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
74 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
75 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
76 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
81 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
86 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
87 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
88 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
91 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
92 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
99 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
100 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
104 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
105 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
106 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
107 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
108 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
109 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
110 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
112 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
113 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
114 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.54
Metatranscriptomes 0
Isolates 24.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.19
Nodule 0
Rhizoplane 2.16
Rhizosphere 56.12
Stem 0
Stem Tuber 0
Unclassified 34.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10069648 3300003322 Bacteria 2203
2 rootL2_10209418 3300003322 Bacteria 2511
3 rootL2_10362244 3300003322 Unclassified 1270
4 rootH1_10011869 3300003323 Bacteria 39408
5 Ga0065714_10005765 3300005288 Bacteria 5782
6 Ga0065704_10071376 3300005289 Bacteria 11419
7 Ga0065715_10141033 3300005293 Bacteria 1853
8 Ga0070682_100545592 3300005337 Bacteria 906
9 Ga0070668_100046336 3300005347 Bacteria 3338
10 Ga0070667_100600028 3300005367 Bacteria 1014
11 Ga0070672_100001695 3300005543 Bacteria 13755
12 Ga0070717_10147642 3300006028 Bacteria 2032
13 Ga0075435_100514725 3300007076 Bacteria 1035
14 Ga0105251_10006724 3300009011 Bacteria 7259
15 Ga0105244_10000038 3300009036 Bacteria 158460
16 Ga0105250_10031567 3300009092 Bacteria 2126
17 Ga0105243_10000149 3300009148 Bacteria 79865
18 Ga0105241_10307142 3300009174 Bacteria 1363
19 Ga0105239_10002136 3300010375 Bacteria 25436
20 Ga0157374_10167469 3300013296 Bacteria 2142
21 Ga0157372_11446567 3300013307 Bacteria 792
22 Ga0157375_10783093 3300013308 Bacteria 1103
23 Ga0182006_1000001 3300015261 Bacteria 1091090
24 Ga0163161_10000019 3300017792 Bacteria 216758
25 Ga0163161_10157143 3300017792 Bacteria 1732
26 Ga0209646_1007402 3300025246 Bacteria 1796
27 Ga0207655_1000034 3300025728 Bacteria 364737
28 Ga0207713_1005129 3300025735 Bacteria 8288
29 Ga0207654_10381779 3300025911 Bacteria 976
30 Ga0207709_10000044 3300025935 Bacteria 241642
31 Ga0207691_10019045 3300025940 Bacteria 6500
32 Ga0207668_10035034 3300025972 Bacteria 3338
33 Ga0207658_10569222 3300025986 Bacteria 1015
34 Ga0307513_10142768 3300031456 Bacteria 2318
35 Ga0307412_10000006 3300031911 Bacteria 506878
36 Ga0307416_100000021 3300032002 Bacteria 189730
37 Ga0307414_10085836 3300032004 Bacteria 2320
38 Ga0307414_10134739 3300032004 Bacteria 1924
39 Ga0307414_10866549 3300032004 Bacteria 826
40 Ga0439436_0003103 3300041404 Bacteria 5038
41 Ga0439439_0001900 3300041406 Bacteria 4315
42 Ga0439447_000010 3300041407 Bacteria 81240
43 Ga0439466_0051241 3300041411 Bacteria 1352
44 Ga0451841_0292577 3300041498 Bacteria 912
45 Ga0451843_1628027 3300041509 Bacteria 828
46 Ga0439445_0000049 3300042004 Bacteria 17022
47 Ga0439456_009218 3300042013 Bacteria 2040
48 Ga0439457_001015 3300042014 Bacteria 8459
49 Ga0466972_0000075 3300044658 Bacteria 94290
50 Ga0466972_0020536 3300044658 Bacteria 3300
51 Ga0466961_0094979 3300044693 Bacteria 1881
52 Ga0495606_0042167 3300046507 Bacteria 3054
53 Ga0495610_0000005 3300046512 Bacteria 924111
54 Ga0495610_0057084 3300046512 Bacteria 1874
55 Ga0495632_0001680 3300046519 Bacteria 18104
56 Ga0495643_0097341 3300046522 Bacteria 1512
57 Ga0495633_0001932 3300046558 Bacteria 15084
58 Ga0495625_0000549 3300046660 Bacteria 54909
59 Ga0495625_0389951 3300046660 Bacteria 872
60 Ga0495672_0133095 3300047320 Bacteria 1306
61 Ga0495686_0000004 3300047472 Bacteria 869019
62 Ga0495686_0000122 3300047472 Bacteria 162732
63 Ga0495686_0007587 3300047472 Bacteria 8107
64 Ga0496116_0005229 3300048919 Bacteria 12141
65 Ga0496116_0012836 3300048919 Bacteria 6808
66 Ga0496117_0025178 3300048920 Bacteria 4684
67 Ga0496118_0056577 3300048921 Bacteria 2947
68 Ga0496119_0004310 3300048922 Bacteria 14204
69 Ga0496120_0001614 3300048923 Bacteria 26146
70 Ga0496120_0134478 3300048923 Bacteria 1262
71 Ga0496121_0000008 3300048924 Bacteria 843593
72 Ga0496121_0054740 3300048924 Bacteria 3331
73 Ga0496121_0121931 3300048924 Bacteria 1967
74 Ga0496122_0000875 3300048925 Bacteria 56698
75 Ga0496122_0001652 3300048925 Bacteria 34608
76 Ga0496122_0014524 3300048925 Bacteria 7602
77 Ga0496122_0117399 3300048925 Bacteria 1727
78 Ga0496122_0174165 3300048925 Unclassified 1292
79 Ga0496122_0311971 3300048925 Bacteria 841
80 Ga0496123_0004690 3300048926 Bacteria 14162
81 Ga0496123_0021068 3300048926 Bacteria 5079
82 Ga0496123_0179642 3300048926 Unclassified 1107
83 Ga0496124_0000522 3300048927 Bacteria 65274
84 Ga0496124_0001846 3300048927 Bacteria 29253
85 Ga0496124_0069539 3300048927 Unclassified 2923
86 Ga0496125_0103594 3300048928 Bacteria 2087
87 Ga0496125_0119040 3300048928 Bacteria 1889
88 Ga0496126_0000444 3300048929 Bacteria 82666
89 Ga0496126_0001548 3300048929 Bacteria 35338
90 Ga0501249_000007 3300049679 Bacteria 198318
91 Ga0501225_0026319 3300049705 Bacteria 1599
92 Ga0501266_000018 3300049763 Bacteria 135236
93 Ga0501044_0008042 3300049823 Bacteria 11583
94 nmdc:mga0rr50_301901_c1 3300050513 Bacteria 1339
95 Ga0500578_0000091 3300053086 Bacteria 102427
96 Ga0500644_0067356 3300053088 Bacteria 1280
97 Ga0500646_0057106 3300053090 Bacteria 1140
98 Ga0500641_0000253 3300053096 Bacteria 19947
99 Ga0500554_149298 3300053102 Bacteria 790
100 Ga0500556_0079918 3300053104 Bacteria 1235
101 Ga0500559_0063348 3300053136 Bacteria 1652
102 Ga0500589_070492 3300053147 Bacteria 1582
103 Ga0500616_0263219 3300053153 Bacteria 731
104 Ga0500584_064180 3300053726 Bacteria 1621
105 Ga0466962_0264736 3300061719 Bacteria 847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053147 Ga0500589_070492 Ga0500589_070492_766_1233 152
2 3300042004 Ga0439445_0000049 Ga0439445_0000049_1022_1564 159
3 iso_pu_bacteria 8056440228 8056440821 161
4 3300041404 Ga0439436_0003103 Ga0439436_0003103_1564_2169 163
5 3300041406 Ga0439439_0001900 Ga0439439_0001900_1091_1696 163
6 3300042014 Ga0439457_001015 Ga0439457_001015_1393_1998 163
7 3300048928 Ga0496125_0119040 Ga0496125_0119040_1162_1704 168
8 3300061719 Ga0466962_0264736 Ga0466962_0264736_52_564 169
9 3300053153 Ga0500616_0263219 Ga0500616_0263219_185_709 171
10 iso_pu_bacteria 2945924605 2945925195 174
11 iso_pu_bacteria 2818991444 2819589550 175
12 iso_pu_bacteria 2582581873 2585426782 176
13 iso_pu_bacteria 2585428045 2587679255 176
14 iso_pu_bacteria 2585428060 2587749647 176
15 iso_pu_bacteria 2585428061 2587753087 176
16 iso_pu_bacteria 2585428095 2587866192 176
17 iso_pu_bacteria 2585428187 2588232314 176
18 iso_pu_bacteria 2588253712 2588447012 176
19 iso_pu_bacteria 2588254257 2590609657 176
20 iso_pu_bacteria 2600255318 2601795970 176
21 iso_pu_bacteria 2603880185 2606075179 176
22 iso_pu_bacteria 2603880199 2606128042 176
23 iso_pu_bacteria 2643221716 2644641703 176
24 iso_pu_bacteria 2728369107 2729201334 176
25 iso_pu_bacteria 2739367874 2740059947 176
26 iso_pu_bacteria 2751185877 2753673736 176
27 iso_pu_bacteria 2772190705 2772605139 176
28 iso_pu_bacteria 2842083920 2842084517 176
29 iso_pu_bacteria 2905999023 2905999506 176
30 iso_pu_bacteria 2946019816 2946023563 176
31 3300048924 Ga0496121_0000008 Ga0496121_0000008_455091_455624 177
32 iso_pu_bacteria 2738541278 2738724861 177
33 3300003322 rootL2_10362244 rootL2_103622442 178
34 iso_pu_bacteria 2643221600 2644012840 178
35 iso_pu_bacteria 2643221667 2644370852 178
36 iso_pu_bacteria 2738541279 2738735625 178
37 iso_pu_bacteria 2738541285 2738768202 178
38 iso_pu_bacteria 2738543007 2739217207 178
39 iso_pu_bacteria 2739367857 2740003625 178
40 iso_pu_bacteria 2739367858 2740008442 178
41 iso_pu_bacteria 2919191525 2919194623 178
42 iso_pu_bacteria 2929150217 2929150997 178
43 3300003322 rootL2_10209418 rootL2_102094182 179
44 3300005289 Ga0065704_10071376 Ga0065704_100713763 179
45 3300005293 Ga0065715_10141033 Ga0065715_101410332 179
46 3300005347 Ga0070668_100046336 Ga0070668_1000463365 179
47 3300005367 Ga0070667_100600028 Ga0070667_1006000282 179
48 3300006028 Ga0070717_10147642 Ga0070717_101476422 179
49 3300009092 Ga0105250_10031567 Ga0105250_100315672 179
50 3300009148 Ga0105243_10000149 Ga0105243_1000014922 179
51 3300009174 Ga0105241_10307142 Ga0105241_103071422 179
52 3300010375 Ga0105239_10002136 Ga0105239_1000213619 179
53 3300013296 Ga0157374_10167469 Ga0157374_101674692 179
54 3300013307 Ga0157372_11446567 Ga0157372_114465671 179
55 3300013308 Ga0157375_10783093 Ga0157375_107830932 179
56 3300015261 Ga0182006_1000001 Ga0182006_1000001316 179
57 3300025246 Ga0209646_1007402 Ga0209646_10074022 179
58 3300025911 Ga0207654_10381779 Ga0207654_103817792 179
59 3300025935 Ga0207709_10000044 Ga0207709_10000044160 179
60 3300025972 Ga0207668_10035034 Ga0207668_100350345 179
61 3300025986 Ga0207658_10569222 Ga0207658_105692222 179
62 3300031911 Ga0307412_10000006 Ga0307412_10000006343 179
63 3300032002 Ga0307416_100000021 Ga0307416_100000021177 179
64 3300032004 Ga0307414_10085836 Ga0307414_100858362 179
65 3300032004 Ga0307414_10134739 Ga0307414_101347393 179
66 3300032004 Ga0307414_10866549 Ga0307414_108665492 179
67 3300041411 Ga0439466_0051241 Ga0439466_0051241_237_782 179
68 3300044658 Ga0466972_0020536 Ga0466972_0020536_306_845 179
69 3300044693 Ga0466961_0094979 Ga0466961_0094979_209_748 179
70 3300046507 Ga0495606_0042167 Ga0495606_0042167_1244_1789 179
71 3300046512 Ga0495610_0000005 Ga0495610_0000005_764285_764827 179
72 3300046519 Ga0495632_0001680 Ga0495632_0001680_16362_16904 179
73 3300046522 Ga0495643_0097341 Ga0495643_0097341_924_1469 179
74 3300046558 Ga0495633_0001932 Ga0495633_0001932_9487_10029 179
75 3300046660 Ga0495625_0000549 Ga0495625_0000549_17541_18083 179
76 3300047320 Ga0495672_0133095 Ga0495672_0133095_130_672 179
77 3300047472 Ga0495686_0000122 Ga0495686_0000122_81425_81970 179
78 3300047472 Ga0495686_0007587 Ga0495686_0007587_6333_6872 179
79 3300048925 Ga0496122_0000875 Ga0496122_0000875_36260_36820 179
80 3300048925 Ga0496122_0001652 Ga0496122_0001652_807_1349 179
81 3300048925 Ga0496122_0014524 Ga0496122_0014524_4208_4750 179
82 3300048926 Ga0496123_0021068 Ga0496123_0021068_1735_2277 179
83 3300048927 Ga0496124_0069539 Ga0496124_0069539_1238_1780 179
84 3300049679 Ga0501249_000007 Ga0501249_000007_185864_186406 179
85 3300053086 Ga0500578_0000091 Ga0500578_0000091_78650_79189 179
86 3300053096 Ga0500641_0000253 Ga0500641_0000253_17446_17994 179
87 3300053102 Ga0500554_149298 Ga0500554_149298_238_777 179
88 iso_pu_bacteria 2588254255 2590603750 179
89 3300005543 Ga0070672_100001695 Ga0070672_1000016954 180
90 3300009011 Ga0105251_10006724 Ga0105251_100067244 180
91 3300017792 Ga0163161_10157143 Ga0163161_101571433 180
92 3300025735 Ga0207713_1005129 Ga0207713_10051295 180
93 3300025940 Ga0207691_10019045 Ga0207691_100190455 180
94 3300042013 Ga0439456_009218 Ga0439456_009218_1088_1633 180
95 3300048921 Ga0496118_0056577 Ga0496118_0056577_1236_1781 180
96 3300048924 Ga0496121_0121931 Ga0496121_0121931_327_872 180
97 3300003322 rootL2_10069648 rootL2_100696482 181
98 3300003323 rootH1_10011869 rootH1_1001186932 181
99 3300005288 Ga0065714_10005765 Ga0065714_100057651 181
100 3300005337 Ga0070682_100545592 Ga0070682_1005455922 181
101 3300007076 Ga0075435_100514725 Ga0075435_1005147251 181
102 3300009036 Ga0105244_10000038 Ga0105244_1000003849 181
103 3300017792 Ga0163161_10000019 Ga0163161_1000001960 181
104 3300025728 Ga0207655_1000034 Ga0207655_100003449 181
105 3300031456 Ga0307513_10142768 Ga0307513_101427682 181
106 3300041407 Ga0439447_000010 Ga0439447_000010_56324_56878 181
107 3300041498 Ga0451841_0292577 Ga0451841_0292577_61_609 181
108 3300041509 Ga0451843_1628027 Ga0451843_1628027_101_649 181
109 3300044658 Ga0466972_0000075 Ga0466972_0000075_56145_56690 181
110 3300046512 Ga0495610_0057084 Ga0495610_0057084_1285_1839 181
111 3300046660 Ga0495625_0389951 Ga0495625_0389951_263_817 181
112 3300047472 Ga0495686_0000004 Ga0495686_0000004_704073_704621 181
113 3300048919 Ga0496116_0005229 Ga0496116_0005229_10516_11112 181
114 3300048919 Ga0496116_0012836 Ga0496116_0012836_2869_3420 181
115 3300048920 Ga0496117_0025178 Ga0496117_0025178_3284_3880 181
116 3300048922 Ga0496119_0004310 Ga0496119_0004310_2194_2790 181
117 3300048923 Ga0496120_0001614 Ga0496120_0001614_22364_22960 181
118 3300048923 Ga0496120_0134478 Ga0496120_0134478_215_811 181
119 3300048924 Ga0496121_0054740 Ga0496121_0054740_725_1279 181
120 3300048925 Ga0496122_0117399 Ga0496122_0117399_823_1374 181
121 3300048925 Ga0496122_0174165 Ga0496122_0174165_319_915 181
122 3300048925 Ga0496122_0311971 Ga0496122_0311971_164_790 181
123 3300048926 Ga0496123_0004690 Ga0496123_0004690_8867_9418 181
124 3300048926 Ga0496123_0179642 Ga0496123_0179642_160_756 181
125 3300048927 Ga0496124_0000522 Ga0496124_0000522_61244_61840 181
126 3300048927 Ga0496124_0001846 Ga0496124_0001846_6313_6864 181
127 3300048928 Ga0496125_0103594 Ga0496125_0103594_714_1265 181
128 3300048929 Ga0496126_0000444 Ga0496126_0000444_13955_14551 181
129 3300048929 Ga0496126_0001548 Ga0496126_0001548_26172_26768 181
130 3300049705 Ga0501225_0026319 Ga0501225_0026319_149_694 181
131 3300049763 Ga0501266_000018 Ga0501266_000018_74550_75098 181
132 3300049823 Ga0501044_0008042 Ga0501044_0008042_784_1380 181
133 3300050513 nmdc:mga0rr50_301901_c1 nmdc:mga0rr50_301901_c1_112_657 181
134 3300053088 Ga0500644_0067356 Ga0500644_0067356_581_1126 181
135 3300053090 Ga0500646_0057106 Ga0500646_0057106_112_657 181
136 3300053104 Ga0500556_0079918 Ga0500556_0079918_184_729 181
137 3300053136 Ga0500559_0063348 Ga0500559_0063348_811_1356 181
138 3300053726 Ga0500584_064180 Ga0500584_064180_251_805 181
139 iso_pu_bacteria 2791355222 2793182625 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01885

PTS_2-RNA

RNA 2'-phosphotransferase, Tpt1 / KptA family

28

196

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e3a-assembly1.cif.gz_A trna 2'-phosphotransferase 0.9329 5 179
6ede-assembly1.cif.gz_A trna 2'-phosphotransferase 0.9244 5 179
8tg3-assembly1.cif.gz_A "trna 2'-phosphotransferase (tpt1) from aeropyrum pernix in complex with adp-ribose-1"" -phosphate" 0.9093 5 178
6ede-assembly1.cif.gz_A trna 2'-phosphotransferase 0.9047 5 179
6e3a-assembly1.cif.gz_A trna 2'-phosphotransferase 0.9032 5 179
ID Description Score Start End Superfamily
af_P39380_102_184_3.20.170.30 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold; 0.9977 98 179 3.20.170.30
af_P39380_10_81_1.10.10.970 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;RNA 2'-phosphotransferase, Tpt1/KptA family, N-terminal domain 0.986 7 77 1.10.10.970
af_P39380_102_184_3.20.170.30 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold; 0.974 98 179 3.20.170.30
af_P39380_10_81_1.10.10.970 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;RNA 2'-phosphotransferase, Tpt1/KptA family, N-terminal domain 0.9594 7 77 1.10.10.970
1wfxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;RNA 2'-phosphotransferase, Tpt1/KptA family, N-terminal domain 0.9234 8 77 1.10.10.970
ID Description Score Start End GO Terms
AF-A0A351XMK9-F1-model_v4 RNA--NAD 2'-phosphotransferase 1 94 178 GO:0000215
GO:0008033
AF-A0A2N9WTI6-F1-model_v4 RNA 2'-phosphotransferase 0.997 89 178 GO:0000215
GO:0008033
AF-A0A353F9A7-F1-model_v4 RNA--NAD 2'-phosphotransferase 0.9967 1 108 GO:0000215
GO:0008033
AF-A0A5P2HBY0-F1-model_v4 RNA 2'-phosphotransferase 0.9966 88 178 GO:0000215
GO:0008033
AF-A0A5N8HHF2-F1-model_v4 RNA--NAD 2'-phosphotransferase 0.9925 94 179 GO:0000215
GO:0008033

Feature Viewer

pLDDT pTM Quality
91.72 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map