F176817

General Info

Members Datasets Scaffolds Average Seq Length
139 109 278 107

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10210280|Ga0307508_102102803
Length 130
Sequence MGELQRGGHRSHGYFTLHLAESTLALVTYIEHDGTRHEVTVADGDSVMQGAVDNMLPGIVGECGGALACATCHCYVDDAWMARVGPPAEMEMQMLECAVEEKQPGSRLSCQITVSDALDGLVVRLPPSQF

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
32 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
33 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
47 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
50 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
51 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
52 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
55 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
56 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
57 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
58 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
59 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
60 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
61 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
62 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
63 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
64 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
65 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
66 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
67 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
68 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
69 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
70 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
71 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
72 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
73 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
74 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
75 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
76 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
77 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
78 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
79 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
88 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
89 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
90 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
91 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
92 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
96 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
97 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
98 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
99 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
100 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
101 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
102 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
103 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
104 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
105 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
106 2751185800 Brucella pituitosa AA2 Isolate Unclassified
107 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
108 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
109 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.4
Metatranscriptomes 0
Isolates 3.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.71
Nodule 0.72
Rhizoplane 0.72
Rhizosphere 65.47
Stem 0
Stem Tuber 0
Unclassified 5.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10210280 3300031616 Bacteria 1546
2 JGI25165J46597_1000156 3300003214 Bacteria 109696
3 rootH2_10042077 3300003320 Bacteria 4705
4 Ga0070666_10582771 3300005335 Bacteria 815
5 Ga0070668_100000589 3300005347 Bacteria 24366
6 Ga0070668_100012902 3300005347 Bacteria 6223
7 Ga0070668_100443801 3300005347 Bacteria 1114
8 Ga0070669_100312431 3300005353 Bacteria 1267
9 Ga0070669_100442165 3300005353 Bacteria 1070
10 Ga0070667_101369833 3300005367 Bacteria 663
11 Ga0070663_100010975 3300005455 Bacteria 5666
12 Ga0070685_10387853 3300005466 Bacteria 964
13 Ga0070706_100331872 3300005467 Bacteria 1418
14 Ga0068853_101727096 3300005539 Bacteria 607
15 Ga0068855_100532983 3300005563 Bacteria 1273
16 Ga0068863_100107945 3300005841 Bacteria 2649
17 Ga0068858_100040144 3300005842 Bacteria 4339
18 Ga0068860_100159223 3300005843 Bacteria 2176
19 Ga0068862_100096071 3300005844 Bacteria 2586
20 Ga0068862_100214807 3300005844 Bacteria 1739
21 Ga0068862_102068577 3300005844 Bacteria 580
22 Ga0075363_100001786 3300006048 Bacteria 8421
23 Ga0075364_10231559 3300006051 Bacteria 1255
24 Ga0075364_10440369 3300006051 Bacteria 890
25 Ga0075367_10000247 3300006178 Bacteria 18374
26 Ga0075428_100047111 3300006844 Bacteria 4735
27 Ga0075430_100099927 3300006846 Bacteria 2423
28 Ga0075430_100521821 3300006846 Bacteria 980
29 Ga0075431_100750807 3300006847 Bacteria 951
30 Ga0075429_100505262 3300006880 Bacteria 1059
31 Ga0105240_10550781 3300009093 Bacteria 1276
32 Ga0111539_10576793 3300009094 Bacteria 1310
33 Ga0114129_10309912 3300009147 Bacteria 2101
34 Ga0105237_10703961 3300009545 Bacteria 1017
35 Ga0157370_10224417 3300013104 Bacteria 1739
36 Ga0213873_10172008 3300021358 Bacteria 661
37 Ga0213872_10023751 3300021361 Bacteria 2820
38 Ga0213872_10126797 3300021361 Bacteria 1126
39 Ga0209437_103147 3300025233 Bacteria 3034
40 Ga0209233_1000213 3300025261 Bacteria 109881
41 Ga0209455_1014498 3300025272 Bacteria 1781
42 Ga0207684_10589597 3300025910 Unclassified 950
43 Ga0207681_10270533 3300025923 Bacteria 1334
44 Ga0207681_10544069 3300025923 Bacteria 955
45 Ga0207644_10462782 3300025931 Bacteria 1043
46 Ga0207667_10509710 3300025949 Bacteria 1220
47 Ga0207668_10000722 3300025972 Bacteria 20222
48 Ga0207668_10132130 3300025972 Bacteria 1907
49 Ga0207658_11415654 3300025986 Bacteria 636
50 Ga0207703_10097922 3300026035 Bacteria 2479
51 Ga0207639_10922865 3300026041 Bacteria 816
52 Ga0207678_10057005 3300026067 Bacteria 3362
53 Ga0209813_10000031 3300027866 Bacteria 65084
54 Ga0268265_10018547 3300028380 Bacteria 4824
55 Ga0268265_10371120 3300028380 Bacteria 1313
56 Ga0268265_10687380 3300028380 Bacteria 987
57 Ga0268264_10977514 3300028381 Bacteria 852
58 Ga0307517_10024137 3300028786 Bacteria 7515
59 Ga0316181_1246550 3300030744 Bacteria 796
60 Ga0307513_10037411 3300031456 Bacteria 5402
61 Ga0307513_10225410 3300031456 Bacteria 1691
62 Ga0307513_10605878 3300031456 Unclassified 804
63 Ga0307509_10000048 3300031507 Bacteria 167101
64 Ga0307509_10123786 3300031507 Bacteria 2557
65 Ga0307508_10005073 3300031616 Bacteria 12639
66 Ga0307414_11391011 3300032004 Bacteria 652
67 Ga0373954_0084844 3300035118 Bacteria 1516
68 Ga0395899_0381403 3300037312 Bacteria 937
69 Ga0395900_0677458 3300037418 Bacteria 966
70 Ga0400483_056864 3300039062 Bacteria 1396
71 Ga0400483_195656 3300039062 Bacteria 2957
72 Ga0436360_0126750 3300039438 Bacteria 705
73 Ga0436360_0310426 3300039438 Bacteria 25508
74 Ga0436360_0690885 3300039438 Bacteria 1450
75 Ga0436361_0142096 3300039447 Unclassified 694
76 Ga0436361_0363111 3300039447 Bacteria 8455
77 Ga0436361_0563373 3300039447 Bacteria 1702
78 Ga0436362_0947636 3300039453 Bacteria 1803
79 Ga0495617_023137 3300046452 Bacteria 2100
80 Ga0495627_105200 3300046453 Bacteria 803
81 Ga0495638_0081769 3300046460 Bacteria 1960
82 Ga0495585_0065367 3300046492 Bacteria 1993
83 Ga0495585_0151894 3300046492 Bacteria 1207
84 Ga0495585_0161646 3300046492 Bacteria 1162
85 Ga0495583_0000184 3300046506 Bacteria 105978
86 Ga0495610_0000196 3300046512 Bacteria 67461
87 Ga0495632_0001605 3300046519 Bacteria 18623
88 Ga0495643_0000027 3300046522 Bacteria 266446
89 Ga0495648_0000026 3300046524 Bacteria 232162
90 Ga0495666_0088323 3300046526 Bacteria 1464
91 Ga0495633_0009093 3300046558 Bacteria 5519
92 Ga0495633_0067348 3300046558 Bacteria 1672
93 Ga0495633_0309296 3300046558 Bacteria 717
94 Ga0495668_0003753 3300046616 Bacteria 11150
95 Ga0495668_0072438 3300046616 Unclassified 1893
96 Ga0495671_0000050 3300046692 Bacteria 141936
97 Ga0495671_0429871 3300046692 Unclassified 632
98 Ga0495673_0000125 3300047469 Bacteria 141937
99 Ga0496108_1204810 3300048911 Bacteria 640
100 Ga0496119_0007941 3300048922 Bacteria 9442
101 Ga0496120_0411681 3300048923 Bacteria 595
102 Ga0496121_0066282 3300048924 Bacteria 2933
103 Ga0496122_0200493 3300048925 Bacteria 1167
104 Ga0496123_0046495 3300048926 Bacteria 2943
105 Ga0496125_0143731 3300048928 Bacteria 1653
106 Ga0496126_0549130 3300048929 Bacteria 917
107 Ga0501034_0811122 3300049571 Bacteria 828
108 Ga0501034_1044858 3300049571 Bacteria 699
109 Ga0501037_0804810 3300049573 Bacteria 620
110 Ga0501039_0576092 3300049575 Bacteria 883
111 Ga0501040_0528821 3300049576 Bacteria 851
112 Ga0501047_0330700 3300049581 Bacteria 1362
113 Ga0501035_0924281 3300049822 Bacteria 690
114 Ga0501044_0610773 3300049823 Bacteria 983
115 nmdc:mga03n38_8875_c1 3300050490 Bacteria 3629
116 nmdc:mga00v17_369848_c1 3300050491 Bacteria 932
117 nmdc:mga0k408_577039_c1 3300050493 Bacteria 664
118 nmdc:mga06z11_83_c1 3300050494 Bacteria 40158
119 nmdc:mga04h51_17_c1 3300050495 Bacteria 75055
120 nmdc:mga0qj67_479210_c1 3300050509 Bacteria 1001
121 nmdc:mga06r32_1158059_c1 3300050510 Bacteria 721
122 nmdc:mga08y16_1336237_c1 3300050511 Unclassified 682
123 Ga0500643_002555 3300053087 Bacteria 9280
124 Ga0500583_0278900 3300053092 Bacteria 821
125 Ga0500566_0477234 3300053094 Unclassified 541
126 Ga0500618_033079 3300053125 Bacteria 1207
127 Ga0500559_0013593 3300053136 Bacteria 3446
128 Ga0500559_0187289 3300053136 Bacteria 975
129 Ga0500588_0004088 3300053146 Bacteria 3133
130 Ga0500604_0041893 3300053151 Unclassified 1386
131 Ga0500622_0012896 3300053156 Bacteria 4515
132 Ga0500624_000121 3300053157 Bacteria 35470
133 Ga0500624_000126 3300053157 Bacteria 34188
134 Ga0500636_0032607 3300053177 Bacteria 3082
135 2514590153 2513237351 Bacteria 6968952
136 2753359319 2751185800 Bacteria 5467370
137 2904770402 2904765812 Bacteria 5369154
138 2915653932 2915650412 Bacteria 4288180
139 2958066966 2958064165 Bacteria 7158582
140 Ga0307508_10210280
141 JGI25165J46597_1000156
142 rootH2_10042077
143 Ga0070666_10582771
144 Ga0070668_100000589
145 Ga0070668_100012902
146 Ga0070668_100443801
147 Ga0070669_100312431
148 Ga0070669_100442165
149 Ga0070667_101369833
150 Ga0070663_100010975
151 Ga0070685_10387853
152 Ga0070706_100331872
153 Ga0068853_101727096
154 Ga0068855_100532983
155 Ga0068863_100107945
156 Ga0068858_100040144
157 Ga0068860_100159223
158 Ga0068862_100096071
159 Ga0068862_100214807
160 Ga0068862_102068577
161 Ga0075363_100001786
162 Ga0075364_10231559
163 Ga0075364_10440369
164 Ga0075367_10000247
165 Ga0075428_100047111
166 Ga0075430_100099927
167 Ga0075430_100521821
168 Ga0075431_100750807
169 Ga0075429_100505262
170 Ga0105240_10550781
171 Ga0111539_10576793
172 Ga0114129_10309912
173 Ga0105237_10703961
174 Ga0157370_10224417
175 Ga0213873_10172008
176 Ga0213872_10023751
177 Ga0213872_10126797
178 Ga0209437_103147
179 Ga0209233_1000213
180 Ga0209455_1014498
181 Ga0207684_10589597
182 Ga0207681_10270533
183 Ga0207681_10544069
184 Ga0207644_10462782
185 Ga0207667_10509710
186 Ga0207668_10000722
187 Ga0207668_10132130
188 Ga0207658_11415654
189 Ga0207703_10097922
190 Ga0207639_10922865
191 Ga0207678_10057005
192 Ga0209813_10000031
193 Ga0268265_10018547
194 Ga0268265_10371120
195 Ga0268265_10687380
196 Ga0268264_10977514
197 Ga0307517_10024137
198 Ga0316181_1246550
199 Ga0307513_10037411
200 Ga0307513_10225410
201 Ga0307513_10605878
202 Ga0307509_10000048
203 Ga0307509_10123786
204 Ga0307508_10005073
205 Ga0307414_11391011
206 Ga0373954_0084844
207 Ga0395899_0381403
208 Ga0395900_0677458
209 Ga0400483_056864
210 Ga0400483_195656
211 Ga0436360_0126750
212 Ga0436360_0310426
213 Ga0436360_0690885
214 Ga0436361_0142096
215 Ga0436361_0363111
216 Ga0436361_0563373
217 Ga0436362_0947636
218 Ga0495617_023137
219 Ga0495627_105200
220 Ga0495638_0081769
221 Ga0495585_0065367
222 Ga0495585_0151894
223 Ga0495585_0161646
224 Ga0495583_0000184
225 Ga0495610_0000196
226 Ga0495632_0001605
227 Ga0495643_0000027
228 Ga0495648_0000026
229 Ga0495666_0088323
230 Ga0495633_0009093
231 Ga0495633_0067348
232 Ga0495633_0309296
233 Ga0495668_0003753
234 Ga0495668_0072438
235 Ga0495671_0000050
236 Ga0495671_0429871
237 Ga0495673_0000125
238 Ga0496108_1204810
239 Ga0496119_0007941
240 Ga0496120_0411681
241 Ga0496121_0066282
242 Ga0496122_0200493
243 Ga0496123_0046495
244 Ga0496125_0143731
245 Ga0496126_0549130
246 Ga0501034_0811122
247 Ga0501034_1044858
248 Ga0501037_0804810
249 Ga0501039_0576092
250 Ga0501040_0528821
251 Ga0501047_0330700
252 Ga0501035_0924281
253 Ga0501044_0610773
254 nmdc:mga03n38_8875_c1
255 nmdc:mga00v17_369848_c1
256 nmdc:mga0k408_577039_c1
257 nmdc:mga06z11_83_c1
258 nmdc:mga04h51_17_c1
259 nmdc:mga0qj67_479210_c1
260 nmdc:mga06r32_1158059_c1
261 nmdc:mga08y16_1336237_c1
262 Ga0500643_002555
263 Ga0500583_0278900
264 Ga0500566_0477234
265 Ga0500618_033079
266 Ga0500559_0013593
267 Ga0500559_0187289
268 Ga0500588_0004088
269 Ga0500604_0041893
270 Ga0500622_0012896
271 Ga0500624_000121
272 Ga0500624_000126
273 Ga0500636_0032607
274 2514590153
275 2753359319
276 2904770402
277 2915653932
278 2958066966

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

30

115

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hui-assembly1.cif.gz_A crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris 0.9936 1 107
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.9802 1 107
4ltu-assembly2.cif.gz_B crystal structure of ferredoxin from rhodopseudomonas palustris haa2 0.9759 3 107
3hui-assembly1.cif.gz_A crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris 0.9753 1 107
1r7s-assembly3.cif.gz_C putidaredoxin (fe2s2 ferredoxin), c73g mutant 0.9752 2 107
ID Description Score Start End Superfamily
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9759 3 107 3.10.20.30
1uwmA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9726 2 107 3.10.20.30
1uwmA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9637 2 107 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.958 3 107 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9423 2 106 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A258FV09-F1-model_v4 2Fe-2S ferredoxin 0.9969 1 107 GO:0005829
GO:0009055
GO:0051537
GO:0140647
AF-A0A6C1KF75-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9954 1 107 GO:0009055
GO:0051537
GO:0140647
AF-A0A370R5A4-F1-model_v4 deleted 0.9947 1 107
AF-A0A370R9H3-F1-model_v4 deleted 0.9947 1 107
AF-A0A4Q3TA31-F1-model_v4 (2Fe-2S)-binding protein 0.9937 1 107 GO:0005829
GO:0009055
GO:0051537
GO:0140647

Map