F175809

General Info

Members Datasets Scaffolds Average Seq Length
139 110 278 87

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_101785270|Ga0068863_1017852701
Length 94
Sequence MKLYVGNLAYSVNDATLRALFEPFGSVESARVISDRDSGTSKGFGFVEMSNSDAQKAMSSLNGRDHDGRALKVNEARPQENRGXXXXFGGRNRY

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
57 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
62 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
96 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
97 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
98 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
102 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
103 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.93
Metatranscriptomes 10.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.16
Rhizosphere 92.09
Stem 0
Stem Tuber 0
Unclassified 14.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_101785270 3300005841 Bacteria 625
2 Ga0058859_11296922 3300004798 Unclassified 913
3 Ga0070683_100560275 3300005329 Unclassified 1093
4 Ga0070677_10298950 3300005333 Unclassified 817
5 Ga0070674_101447018 3300005356 Bacteria 616
6 Ga0070714_100518202 3300005435 Bacteria 1139
7 Ga0070701_10532189 3300005438 Bacteria 768
8 Ga0070681_10007224 3300005458 Bacteria 10836
9 Ga0070698_101161047 3300005471 Bacteria 721
10 Ga0070699_100130418 3300005518 Bacteria 2216
11 Ga0070672_100426894 3300005543 Bacteria 1139
12 Ga0070704_100003049 3300005549 Bacteria 9531
13 Ga0070704_101728809 3300005549 Bacteria 578
14 Ga0068855_100065190 3300005563 Unclassified 4246
15 Ga0068856_102368761 3300005614 Unclassified 538
16 Ga0068859_100000002 3300005617 Bacteria 541370
17 Ga0068858_101280337 3300005842 Bacteria 721
18 Ga0081539_10007791 3300005985 Bacteria 9587
19 Ga0070717_11269106 3300006028 Bacteria 670
20 Ga0075431_100074338 3300006847 Bacteria 3507
21 Ga0097620_100000002 3300006931 Bacteria 541370
22 Ga0105240_10032609 3300009093 Bacteria 6743
23 Ga0111539_10539206 3300009094 Unclassified 1359
24 Ga0114129_12905003 3300009147 Unclassified 566
25 Ga0105242_10606126 3300009176 Bacteria 1058
26 Ga0105242_11419627 3300009176 Unclassified 722
27 Ga0105248_11765684 3300009177 Bacteria 701
28 Ga0105248_12507822 3300009177 Bacteria 588
29 Ga0105249_10280349 3300009553 Bacteria 1664
30 Ga0105239_11217028 3300010375 Bacteria 868
31 Ga0157370_10064262 3300013104 Bacteria 3475
32 Ga0157369_10658230 3300013105 Bacteria 1080
33 Ga0157369_11605049 3300013105 Unclassified 661
34 Ga0163162_11938468 3300013306 Bacteria 675
35 Ga0157372_10805591 3300013307 Bacteria 1091
36 Ga0157372_11701791 3300013307 Bacteria 726
37 Ga0157375_12262832 3300013308 Unclassified 648
38 Ga0163163_11523501 3300014325 Bacteria 730
39 Ga0163161_10425334 3300017792 Bacteria 1069
40 Ga0163161_11320873 3300017792 Bacteria 627
41 Ga0206356_10487768 3300020070 Bacteria 624
42 Ga0206352_10171883 3300020078 Bacteria 615
43 Ga0213875_10569045 3300021388 Bacteria 547
44 Ga0207682_10141101 3300025893 Bacteria 1081
45 Ga0207642_10455357 3300025899 Bacteria 776
46 Ga0207680_11142768 3300025903 Bacteria 556
47 Ga0207695_10001250 3300025913 Bacteria 43452
48 Ga0207662_10258918 3300025918 Bacteria 1145
49 Ga0207650_10857733 3300025925 Unclassified 770
50 Ga0207664_10491879 3300025929 Bacteria 1098
51 Ga0207686_11176271 3300025934 Bacteria 627
52 Ga0207669_11301485 3300025937 Bacteria 617
53 Ga0207691_10245030 3300025940 Unclassified 1548
54 Ga0207667_10085087 3300025949 Unclassified 3274
55 Ga0207712_10345404 3300025961 Bacteria 1235
56 Ga0207712_10658539 3300025961 Bacteria 911
57 Ga0207640_11303051 3300025981 Bacteria 648
58 Ga0207703_11384948 3300026035 Bacteria 676
59 Ga0207702_10914780 3300026078 Bacteria 869
60 Ga0207675_102304564 3300026118 Unclassified 552
61 Ga0265318_10176345 3300028577 Bacteria 783
62 Ga0265338_10113479 3300028800 Bacteria 2177
63 Ga0265338_10333114 3300028800 Bacteria 1096
64 Ga0316177_1116993 3300030731 Bacteria 582
65 Ga0265762_1013057 3300030760 Bacteria 1494
66 Ga0265777_123242 3300030877 Bacteria 522
67 Ga0265340_10525335 3300031247 Bacteria 521
68 Ga0307408_100093489 3300031548 Bacteria 2275
69 Ga0307408_100924581 3300031548 Bacteria 800
70 Ga0307408_101770188 3300031548 Unclassified 590
71 Ga0310117_128595 3300031592 Bacteria 543
72 Ga0316575_10294667 3300031665 Bacteria 685
73 Ga0307405_10001591 3300031731 Bacteria 9635
74 Ga0307413_10006971 3300031824 Bacteria 5207
75 Ga0307413_10036399 3300031824 Bacteria 2832
76 Ga0307410_10004657 3300031852 Bacteria 7127
77 Ga0307410_10473952 3300031852 Bacteria 1025
78 Ga0307406_10026131 3300031901 Bacteria 3502
79 Ga0307406_11490829 3300031901 Bacteria 595
80 Ga0307407_10003645 3300031903 Bacteria 6369
81 Ga0307407_10578551 3300031903 Bacteria 833
82 Ga0307412_10040211 3300031911 Bacteria 3025
83 Ga0307409_100019024 3300031995 Bacteria 4637
84 Ga0307409_100373571 3300031995 Bacteria 1353
85 Ga0307409_101021560 3300031995 Unclassified 845
86 Ga0307409_101089582 3300031995 Bacteria 820
87 Ga0307416_100005618 3300032002 Bacteria 7734
88 Ga0307414_10172759 3300032004 Bacteria 1729
89 Ga0307411_10007532 3300032005 Bacteria 5558
90 Ga0307411_11605034 3300032005 Bacteria 600
91 Ga0307415_100008602 3300032126 Bacteria 5668
92 Ga0307415_100019506 3300032126 Unclassified 4118
93 Ga0316593_10234949 3300032168 Bacteria 683
94 Ga0316586_1123674 3300033527 Bacteria 506
95 Ga0316587_1124825 3300033529 Bacteria 506
96 Ga0316587_1124919 3300033529 Bacteria 506
97 Ga0316587_1128024 3300033529 Bacteria 500
98 Ga0373943_0408465 3300035170 Bacteria 785
99 Ga0373931_0232585 3300035691 Bacteria 1114
100 Ga0395900_0507204 3300037418 Bacteria 1156
101 Ga0395905_0064483 3300037471 Bacteria 3428
102 Ga0395905_1142662 3300037471 Bacteria 682
103 Ga0436364_0395825 3300037853 Bacteria 655
104 Ga0436364_1193133 3300037853 Bacteria 838
105 Ga0436363_0853807 3300039450 Bacteria 720
106 Ga0436363_0940508 3300039450 Bacteria 960
107 Ga0436363_1662972 3300039450 Bacteria 818
108 Ga0451800_0504911 3300041459 Bacteria 760
109 Ga0451577_0000957 3300042876 Bacteria 42277
110 Ga0451577_0949981 3300042876 Bacteria 773
111 Ga0453684_0000216 3300044712 Bacteria 250915
112 Ga0451576_0133894 3300045051 Bacteria 2584
113 Ga0451576_0875356 3300045051 Bacteria 943
114 Ga0495592_0319040 3300046454 Bacteria 1005
115 Ga0495586_0077033 3300046535 Bacteria 1828
116 Ga0496100_0773267 3300048903 Bacteria 752
117 Ga0496105_1218122 3300048908 Bacteria 553
118 Ga0501034_0000508 3300049571 Bacteria 62672
119 Ga0501040_1235003 3300049576 Bacteria 542
120 Ga0501047_0431948 3300049581 Bacteria 1148
121 Ga0501074_0507863 3300049590 Bacteria 854
122 Ga0501201_021822 3300049651 Unclassified 683
123 Ga0501202_082438 3300049652 Unclassified 758
124 Ga0501257_049246 3300049686 Bacteria 1048
125 Ga0501225_0006936 3300049705 Bacteria 3299
126 Ga0501080_0547173 3300049742 Bacteria 1031
127 Ga0501083_0022712 3300049744 Bacteria 4353
128 Ga0501263_014775 3300049760 Bacteria 1003
129 Ga0501267_001329 3300049764 Bacteria 2100
130 Ga0501267_006209 3300049764 Bacteria 1145
131 Ga0501268_000033 3300049765 Bacteria 11375
132 Ga0495601_0167879 3300053077 Bacteria 1434
133 Ga0495619_0614298 3300053085 Bacteria 743
134 Ga0501084_0330244 3300054114 Bacteria 1288
135 Ga0501084_1174563 3300054114 Bacteria 644
136 Ga0587109_124230 3300059624 Unclassified 616
137 Ga0587128_094320 3300059630 Bacteria 618
138 Ga0587114_088521 3300059655 Bacteria 587
139 Ga0501082_1805218 3300060353 Bacteria 533
140 Ga0068863_101785270
141 Ga0058859_11296922
142 Ga0070683_100560275
143 Ga0070677_10298950
144 Ga0070674_101447018
145 Ga0070714_100518202
146 Ga0070701_10532189
147 Ga0070681_10007224
148 Ga0070698_101161047
149 Ga0070699_100130418
150 Ga0070672_100426894
151 Ga0070704_100003049
152 Ga0070704_101728809
153 Ga0068855_100065190
154 Ga0068856_102368761
155 Ga0068859_100000002
156 Ga0068858_101280337
157 Ga0081539_10007791
158 Ga0070717_11269106
159 Ga0075431_100074338
160 Ga0097620_100000002
161 Ga0105240_10032609
162 Ga0111539_10539206
163 Ga0114129_12905003
164 Ga0105242_10606126
165 Ga0105242_11419627
166 Ga0105248_11765684
167 Ga0105248_12507822
168 Ga0105249_10280349
169 Ga0105239_11217028
170 Ga0157370_10064262
171 Ga0157369_10658230
172 Ga0157369_11605049
173 Ga0163162_11938468
174 Ga0157372_10805591
175 Ga0157372_11701791
176 Ga0157375_12262832
177 Ga0163163_11523501
178 Ga0163161_10425334
179 Ga0163161_11320873
180 Ga0206356_10487768
181 Ga0206352_10171883
182 Ga0213875_10569045
183 Ga0207682_10141101
184 Ga0207642_10455357
185 Ga0207680_11142768
186 Ga0207695_10001250
187 Ga0207662_10258918
188 Ga0207650_10857733
189 Ga0207664_10491879
190 Ga0207686_11176271
191 Ga0207669_11301485
192 Ga0207691_10245030
193 Ga0207667_10085087
194 Ga0207712_10345404
195 Ga0207712_10658539
196 Ga0207640_11303051
197 Ga0207703_11384948
198 Ga0207702_10914780
199 Ga0207675_102304564
200 Ga0265318_10176345
201 Ga0265338_10113479
202 Ga0265338_10333114
203 Ga0316177_1116993
204 Ga0265762_1013057
205 Ga0265777_123242
206 Ga0265340_10525335
207 Ga0307408_100093489
208 Ga0307408_100924581
209 Ga0307408_101770188
210 Ga0310117_128595
211 Ga0316575_10294667
212 Ga0307405_10001591
213 Ga0307413_10006971
214 Ga0307413_10036399
215 Ga0307410_10004657
216 Ga0307410_10473952
217 Ga0307406_10026131
218 Ga0307406_11490829
219 Ga0307407_10003645
220 Ga0307407_10578551
221 Ga0307412_10040211
222 Ga0307409_100019024
223 Ga0307409_100373571
224 Ga0307409_101021560
225 Ga0307409_101089582
226 Ga0307416_100005618
227 Ga0307414_10172759
228 Ga0307411_10007532
229 Ga0307411_11605034
230 Ga0307415_100008602
231 Ga0307415_100019506
232 Ga0316593_10234949
233 Ga0316586_1123674
234 Ga0316587_1124825
235 Ga0316587_1124919
236 Ga0316587_1128024
237 Ga0373943_0408465
238 Ga0373931_0232585
239 Ga0395900_0507204
240 Ga0395905_0064483
241 Ga0395905_1142662
242 Ga0436364_0395825
243 Ga0436364_1193133
244 Ga0436363_0853807
245 Ga0436363_0940508
246 Ga0436363_1662972
247 Ga0451800_0504911
248 Ga0451577_0000957
249 Ga0451577_0949981
250 Ga0453684_0000216
251 Ga0451576_0133894
252 Ga0451576_0875356
253 Ga0495592_0319040
254 Ga0495586_0077033
255 Ga0496100_0773267
256 Ga0496105_1218122
257 Ga0501034_0000508
258 Ga0501040_1235003
259 Ga0501047_0431948
260 Ga0501074_0507863
261 Ga0501201_021822
262 Ga0501202_082438
263 Ga0501257_049246
264 Ga0501225_0006936
265 Ga0501080_0547173
266 Ga0501083_0022712
267 Ga0501263_014775
268 Ga0501267_001329
269 Ga0501267_006209
270 Ga0501268_000033
271 Ga0495601_0167879
272 Ga0495619_0614298
273 Ga0501084_0330244
274 Ga0501084_1174563
275 Ga0587109_124230
276 Ga0587128_094320
277 Ga0587114_088521
278 Ga0501082_1805218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00076

RRM_1

RNA recognition motif

3

72

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ljm-assembly2.cif.gz_A crystal structure of c-terminal rna recognition motif of human etr3 0.9844 4 78
4uqt-assembly1.cif.gz_A rrm-peptide structure in res complex 0.9719 4 78
4fxv-assembly3.cif.gz_C crystal structure of an elav-like protein 1 (elavl1) from homo sapiens at 1.90 a resolution 0.9657 3 81
3ulh-assembly1.cif.gz_A-2 crystal structure of a rna binding domain of tho complex subunit 4 protein (thoc4) from homo sapiens at 2.54 a resolution 0.9652 3 78
6gc5-assembly6.cif.gz_D molecular basis for au-rich element recognition and dimerization by the hur c-terminal rrm 0.963 1 78
ID Description Score Start End Superfamily
af_I1JXD6_208_306_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9866 3 77 3.30.70.330
af_A0A0P0WGS4_373_469_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9859 4 79 3.30.70.330
af_Q4E419_3_118_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9857 4 77 3.30.70.330
af_Q7XAN8_312_425_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.984 4 78 3.30.70.330
af_Q4D7Y1_186_276_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9831 3 80 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A401KL86-F1-model_v4 Putative RNA-binding protein RbpF 0.9905 1 80 GO:0003723
AF-A0A4Q5XR14-F1-model_v4 deleted 0.9903 1 79
AF-A0A7C4UN35-F1-model_v4 RNA-binding protein 0.9859 1 82 GO:0003729
AF-A0A811R8Q1-F1-model_v4 Kinesin-like protein 0.9841 1 79 GO:0003723
GO:0003777
GO:0005524
GO:0005874
GO:0007018
GO:0008017
AF-A0A316Z5L9-F1-model_v4 RNA-binding domain-containing protein 0.983 1 82 GO:0003723

Map