F174790

General Info

Members Datasets Scaffolds Average Seq Length
138 101 276 337

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2895880812|2895886105
Length 361
Sequence TPFQTTLKDWETDQEVRWCPGCGDYAILKAVQRTLPQIGANPATTVFISGIGCSSRFPYYMESYGFHTIHGRAPAVATGVKLANPELDIWLVTGDGDGLSIGGNHLMHVLRRNVNMQIMLFNNEIYGLTKGQSSPTSREGTKSPSTPLGSYDHPARPAAFALGSGARFVGRGFDVSKNLPDVLKAAHAHQGAAFIEIFQNCVVYNKDVFDDFAQPKGAEDRQLWLQDGEPMLFGSDRSPGGMQGIALDRDRLRLMVVPVVDGDWQSAGVLVHDVTNRSIAHMLVEMPFGPFPMALGVLYDDPTPTFEAAVALEREQASAGKDANLAKLLGKGQSWTVEGNGPEPFDSRPPGQGAPDAADPL

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
75 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
76 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
77 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
83 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
84 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
97 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
98 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
99 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
100 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
101 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0.72
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 0
Rhizoplane 1.45
Rhizosphere 88.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c002826 3300000041 Bacteria 1580
2 Ga0055542_1000020 3300003762 Bacteria 335745
3 Ga0055536_1000643 3300003781 Bacteria 23754
4 Ga0055531_10005365 3300003794 Bacteria 7516
5 Ga0070658_10016010 3300005327 Bacteria 5998
6 Ga0070658_10017030 3300005327 Bacteria 5816
7 Ga0070683_100001509 3300005329 Bacteria 17973
8 Ga0070660_100019951 3300005339 Bacteria 4918
9 Ga0070660_100280006 3300005339 Bacteria 1364
10 Ga0070668_100156817 3300005347 Bacteria 1844
11 Ga0070669_100075631 3300005353 Bacteria 2498
12 Ga0070667_100000030 3300005367 Bacteria 178327
13 Ga0070667_100012789 3300005367 Bacteria 6935
14 Ga0070711_100054120 3300005439 Bacteria 2769
15 Ga0070663_100077411 3300005455 Bacteria 2435
16 Ga0070662_100008914 3300005457 Bacteria 6539
17 Ga0070681_10007063 3300005458 Bacteria 10934
18 Ga0070679_100013104 3300005530 Bacteria 7939
19 Ga0070684_100059022 3300005535 Bacteria 3354
20 Ga0068853_100215000 3300005539 Bacteria 1753
21 Ga0070665_100004137 3300005548 Bacteria 15260
22 Ga0070665_100256179 3300005548 Bacteria 1751
23 Ga0068855_100018101 3300005563 Bacteria 8466
24 Ga0068855_100276545 3300005563 Bacteria 1866
25 Ga0068857_100004740 3300005577 Bacteria 11521
26 Ga0068861_100008147 3300005719 Bacteria 7208
27 Ga0068863_100000052 3300005841 Bacteria 125430
28 Ga0068863_100000093 3300005841 Bacteria 96862
29 Ga0068858_100002958 3300005842 Bacteria 17069
30 Ga0068858_100017450 3300005842 Bacteria 6733
31 Ga0068860_100000007 3300005843 Bacteria 429329
32 Ga0068860_100080152 3300005843 Bacteria 3105
33 Ga0068862_100005331 3300005844 Bacteria 10774
34 Ga0081538_10000566 3300005981 Bacteria 40988
35 Ga0081539_10066268 3300005985 Bacteria 1958
36 Ga0075366_10001643 3300006195 Bacteria 11223
37 Ga0075370_10072024 3300006353 Bacteria 1978
38 Ga0111539_10013407 3300009094 Bacteria 10248
39 Ga0111539_10050609 3300009094 Bacteria 4949
40 Ga0105245_10015210 3300009098 Bacteria 6704
41 Ga0105245_10080281 3300009098 Bacteria 2980
42 Ga0114129_10025549 3300009147 Bacteria 8367
43 Ga0114129_10151105 3300009147 Bacteria 3178
44 Ga0105238_10294889 3300009551 Bacteria 1605
45 Ga0105246_10001017 3300011119 Bacteria 16103
46 Ga0163162_10128201 3300013306 Bacteria 2645
47 Ga0163162_10285395 3300013306 Bacteria 1782
48 Ga0157372_10581402 3300013307 Bacteria 1305
49 Ga0157377_10050000 3300014745 Bacteria 2352
50 Ga0206356_11319875 3300020070 Bacteria 3433
51 Ga0209257_1035585 3300025304 Bacteria 1539
52 Ga0207680_10002317 3300025903 Bacteria 8867
53 Ga0207705_10007168 3300025909 Bacteria 8213
54 Ga0207657_10000150 3300025919 Bacteria 70716
55 Ga0207657_10268054 3300025919 Bacteria 1358
56 Ga0207652_10019183 3300025921 Bacteria 5620
57 Ga0207652_10051483 3300025921 Bacteria 3531
58 Ga0207681_10020834 3300025923 Bacteria 4161
59 Ga0207706_10005212 3300025933 Bacteria 12132
60 Ga0207706_10006150 3300025933 Bacteria 11149
61 Ga0207661_10035998 3300025944 Bacteria 3861
62 Ga0207667_10015758 3300025949 Bacteria 8571
63 Ga0207667_10389217 3300025949 Bacteria 1420
64 Ga0207668_10000066 3300025972 Bacteria 84452
65 Ga0207658_10000019 3300025986 Bacteria 206335
66 Ga0207658_10001909 3300025986 Bacteria 15589
67 Ga0207703_10000484 3300026035 Bacteria 41489
68 Ga0207703_10011932 3300026035 Bacteria 6767
69 Ga0207641_10000029 3300026088 Bacteria 229383
70 Ga0207641_10000042 3300026088 Bacteria 186384
71 Ga0207674_10013559 3300026116 Bacteria 9034
72 Ga0207674_10109229 3300026116 Bacteria 2742
73 Ga0209969_1003028 3300027360 Bacteria 2325
74 Ga0209974_10007400 3300027876 Bacteria 3785
75 Ga0268266_10017014 3300028379 Bacteria 6212
76 Ga0268265_10039817 3300028380 Bacteria 3466
77 Ga0268264_10000134 3300028381 Bacteria 179475
78 Ga0268264_10091452 3300028381 Bacteria 2625
79 Ga0265323_10005047 3300028653 Bacteria 5637
80 Ga0265327_10139689 3300031251 Bacteria 1133
81 Ga0307508_10008321 3300031616 Bacteria 9593
82 Ga0316575_10031494 3300031665 Bacteria 2076
83 Ga0307405_10024990 3300031731 Bacteria 3422
84 Ga0307413_10024307 3300031824 Bacteria 3301
85 Ga0307412_10020528 3300031911 Bacteria 4022
86 Ga0316574_0089042 3300035398 Bacteria 1966
87 Ga0373937_0117359 3300036401 Bacteria 2479
88 Ga0395899_0100296 3300037312 Bacteria 2091
89 Ga0395900_0004582 3300037418 Bacteria 14585
90 Ga0395900_0035093 3300037418 Bacteria 5166
91 Ga0395898_0007785 3300037466 Bacteria 11371
92 Ga0395898_0073588 3300037466 Bacteria 3301
93 Ga0395898_0227809 3300037466 Bacteria 1777
94 Ga0395898_0285402 3300037466 Bacteria 1574
95 Ga0395905_0035980 3300037471 Bacteria 4649
96 Ga0395905_0044397 3300037471 Bacteria 4171
97 Ga0395901_0035886 3300038443 Bacteria 5123
98 Ga0395901_0060151 3300038443 Bacteria 3952
99 Ga0395901_0061062 3300038443 Bacteria 3922
100 Ga0395901_0575712 3300038443 Bacteria 1138
101 Ga0395901_0608951 3300038443 Bacteria 1100
102 Ga0439461_0000048 3300041410 Bacteria 14369
103 Ga0451853_0970676 3300041512 Bacteria 1097
104 Ga0439431_0000147 3300041997 Bacteria 12816
105 Ga0439442_002919 3300042002 Bacteria 3368
106 Ga0439445_0013796 3300042004 Bacteria 1959
107 Ga0439462_0001461 3300042015 Bacteria 5271
108 Ga0451577_0000266 3300042876 Bacteria 103006
109 Ga0451577_0009855 3300042876 Bacteria 9154
110 Ga0453683_0004073 3300044673 Bacteria 10519
111 Ga0453683_0017028 3300044673 Bacteria 4685
112 Ga0453684_0000844 3300044712 Bacteria 103386
113 Ga0453684_0079015 3300044712 Bacteria 4113
114 Ga0453684_0118827 3300044712 Bacteria 3196
115 Ga0495650_0001651 3300046471 Bacteria 20626
116 Ga0495631_0161968 3300046518 Bacteria 960
117 Ga0495656_0020310 3300046615 Bacteria 2575
118 Ga0495659_0034885 3300046664 Bacteria 1771
119 Ga0495581_0058914 3300047315 Bacteria 2218
120 Ga0495684_0193369 3300047471 Bacteria 1503
121 Ga0496103_0053285 3300048906 Bacteria 2507
122 Ga0496105_0000435 3300048908 Bacteria 27394
123 Ga0496118_0016413 3300048921 Bacteria 6795
124 Ga0496121_0000740 3300048924 Bacteria 60212
125 Ga0496121_0002895 3300048924 Bacteria 25241
126 Ga0496126_0070015 3300048929 Bacteria 3127
127 Ga0501038_0037422 3300049574 Bacteria 4254
128 Ga0501069_0077896 3300049585 Bacteria 1864
129 Ga0501075_0149897 3300049591 Bacteria 1778
130 nmdc:mga05p37_288474_c1 3300050507 Bacteria 1954
131 nmdc:mga05p37_362900_c1 3300050507 Bacteria 1702
132 nmdc:mga05p37_67136_c1 3300050507 Bacteria 4412
133 nmdc:mga08y16_86474_c1 3300050511 Bacteria 3267
134 nmdc:mga0rr50_227197_c1 3300050513 Bacteria 1543
135 Ga0495619_0046151 3300053085 Bacteria 2864
136 Ga0500643_001924 3300053087 Bacteria 11266
137 2895886105 2895880812 Bacteria 11255272
138 2896255409 2896253425 Bacteria 3418029
139 ARcpr5oldR_c002826
140 Ga0055542_1000020
141 Ga0055536_1000643
142 Ga0055531_10005365
143 Ga0070658_10016010
144 Ga0070658_10017030
145 Ga0070683_100001509
146 Ga0070660_100019951
147 Ga0070660_100280006
148 Ga0070668_100156817
149 Ga0070669_100075631
150 Ga0070667_100000030
151 Ga0070667_100012789
152 Ga0070711_100054120
153 Ga0070663_100077411
154 Ga0070662_100008914
155 Ga0070681_10007063
156 Ga0070679_100013104
157 Ga0070684_100059022
158 Ga0068853_100215000
159 Ga0070665_100004137
160 Ga0070665_100256179
161 Ga0068855_100018101
162 Ga0068855_100276545
163 Ga0068857_100004740
164 Ga0068861_100008147
165 Ga0068863_100000052
166 Ga0068863_100000093
167 Ga0068858_100002958
168 Ga0068858_100017450
169 Ga0068860_100000007
170 Ga0068860_100080152
171 Ga0068862_100005331
172 Ga0081538_10000566
173 Ga0081539_10066268
174 Ga0075366_10001643
175 Ga0075370_10072024
176 Ga0111539_10013407
177 Ga0111539_10050609
178 Ga0105245_10015210
179 Ga0105245_10080281
180 Ga0114129_10025549
181 Ga0114129_10151105
182 Ga0105238_10294889
183 Ga0105246_10001017
184 Ga0163162_10128201
185 Ga0163162_10285395
186 Ga0157372_10581402
187 Ga0157377_10050000
188 Ga0206356_11319875
189 Ga0209257_1035585
190 Ga0207680_10002317
191 Ga0207705_10007168
192 Ga0207657_10000150
193 Ga0207657_10268054
194 Ga0207652_10019183
195 Ga0207652_10051483
196 Ga0207681_10020834
197 Ga0207706_10005212
198 Ga0207706_10006150
199 Ga0207661_10035998
200 Ga0207667_10015758
201 Ga0207667_10389217
202 Ga0207668_10000066
203 Ga0207658_10000019
204 Ga0207658_10001909
205 Ga0207703_10000484
206 Ga0207703_10011932
207 Ga0207641_10000029
208 Ga0207641_10000042
209 Ga0207674_10013559
210 Ga0207674_10109229
211 Ga0209969_1003028
212 Ga0209974_10007400
213 Ga0268266_10017014
214 Ga0268265_10039817
215 Ga0268264_10000134
216 Ga0268264_10091452
217 Ga0265323_10005047
218 Ga0265327_10139689
219 Ga0307508_10008321
220 Ga0316575_10031494
221 Ga0307405_10024990
222 Ga0307413_10024307
223 Ga0307412_10020528
224 Ga0316574_0089042
225 Ga0373937_0117359
226 Ga0395899_0100296
227 Ga0395900_0004582
228 Ga0395900_0035093
229 Ga0395898_0007785
230 Ga0395898_0073588
231 Ga0395898_0227809
232 Ga0395898_0285402
233 Ga0395905_0035980
234 Ga0395905_0044397
235 Ga0395901_0035886
236 Ga0395901_0060151
237 Ga0395901_0061062
238 Ga0395901_0575712
239 Ga0395901_0608951
240 Ga0439461_0000048
241 Ga0451853_0970676
242 Ga0439431_0000147
243 Ga0439442_002919
244 Ga0439445_0013796
245 Ga0439462_0001461
246 Ga0451577_0000266
247 Ga0451577_0009855
248 Ga0453683_0004073
249 Ga0453683_0017028
250 Ga0453684_0000844
251 Ga0453684_0079015
252 Ga0453684_0118827
253 Ga0495650_0001651
254 Ga0495631_0161968
255 Ga0495656_0020310
256 Ga0495659_0034885
257 Ga0495581_0058914
258 Ga0495684_0193369
259 Ga0496103_0053285
260 Ga0496105_0000435
261 Ga0496118_0016413
262 Ga0496121_0000740
263 Ga0496121_0002895
264 Ga0496126_0070015
265 Ga0501038_0037422
266 Ga0501069_0077896
267 Ga0501075_0149897
268 nmdc:mga05p37_288474_c1
269 nmdc:mga05p37_362900_c1
270 nmdc:mga05p37_67136_c1
271 nmdc:mga08y16_86474_c1
272 nmdc:mga0rr50_227197_c1
273 Ga0495619_0046151
274 Ga0500643_001924
275 2895886105
276 2896255409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

50

197

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.8692 5 334
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.8522 5 334
6cip-assembly2.cif.gz_C pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound 0.795 24 207
6cio-assembly3.cif.gz_F pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound 0.7936 23 207
6cio-assembly3.cif.gz_E pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound 0.7885 23 207
ID Description Score Start End Superfamily
af_O53181_117_260_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8938 87 221 3.40.50.970
af_Q57957_74_243_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8709 81 210 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8649 78 220 3.40.50.970
af_O53181_117_260_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8355 87 221 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8223 78 220 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7W0SPN8-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9806 9 123 GO:0000287
GO:0016625
GO:0030976
AF-A0A382MXN2-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9747 40 130 GO:0016625
GO:0030976
AF-A0A6G2KY25-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9746 9 117 GO:0006082
GO:0016625
GO:0030976
GO:0044272
AF-A0A101HFI5-F1-model_v4 2-oxoglutarate ferredoxin oxidoreductase subunit beta (EC 1.2.7.3) 0.974 9 123 GO:0030976
GO:0047553
AF-A0A845BT99-F1-model_v4 deleted 0.9731 4 113

Map