F173174

General Info

Members Datasets Scaffolds Average Seq Length
138 104 137 96

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_13091164|Ga0157380_130911642
Length 105
Sequence MLSKQPDMFKELDPLLHSQLRLSVVSLLVATKQAEFSYLKEKTGATAGNLSVQLTKLLDAGYIEVEKTFRDNYPLTTCRISKKGLKAFEDYVNNLKAYIQPTTKK

Samples

Sample ID Description Type Environment
1 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
63 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
64 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
71 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
72 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
73 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
74 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
79 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
80 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
81 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
85 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
86 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
87 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
88 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
89 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
90 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
91 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
92 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
93 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
94 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
95 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
96 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
100 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
101 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
102 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
103 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
104 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.42
Nodule 0
Rhizoplane 4.35
Rhizosphere 77.54
Stem 0
Stem Tuber 0
Unclassified 8.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10150039 3300003320 Bacteria 2997
2 rootL2_10008586 3300003322 Bacteria 12625
3 rootL2_10035027 3300003322 Bacteria 2672
4 rootL2_10058734 3300003322 Unclassified 2998
5 rootL2_10064706 3300003322 Bacteria 6179
6 rootL2_10214288 3300003322 Unclassified 4425
7 rootH1_10260401 3300003323 Bacteria 3310
8 Ga0055530_10038353 3300003791 Bacteria 1192
9 Ga0065165_1002268 3300005262 Bacteria 16967
10 Ga0070658_10950229 3300005327 Bacteria 747
11 Ga0070689_100140611 3300005340 Bacteria 1941
12 Ga0070668_100206711 3300005347 Bacteria 1613
13 Ga0070671_101045268 3300005355 Viruses 716
14 Ga0070688_100098286 3300005365 Bacteria 1925
15 Ga0070685_10007897 3300005466 Bacteria 5451
16 Ga0070693_100149162 3300005547 Bacteria 1479
17 Ga0070665_100002830 3300005548 Bacteria 18789
18 Ga0070665_102513616 3300005548 Unclassified 516
19 Ga0068855_101728488 3300005563 Unclassified 637
20 Ga0068856_100270758 3300005614 Unclassified 1714
21 Ga0068852_100134653 3300005616 Bacteria 2280
22 Ga0068859_100376443 3300005617 Bacteria 1515
23 Ga0068863_100137728 3300005841 Bacteria 2332
24 Ga0068860_100049105 3300005843 Bacteria 4021
25 Ga0068862_102265841 3300005844 Bacteria 555
26 Ga0070716_100123470 3300006173 Bacteria 1625
27 Ga0068871_100001922 3300006358 Bacteria 14062
28 Ga0075428_100041734 3300006844 Bacteria 5043
29 Ga0075428_100129618 3300006844 Bacteria 2744
30 Ga0075428_100685550 3300006844 Bacteria 1092
31 Ga0097620_100376443 3300006931 Bacteria 1515
32 Ga0111539_10005387 3300009094 Bacteria 16546
33 Ga0111539_10039936 3300009094 Bacteria 5651
34 Ga0105237_10328046 3300009545 Bacteria 1534
35 Ga0105237_11132921 3300009545 Bacteria 789
36 Ga0105239_10000249 3300010375 Bacteria 80515
37 Ga0105239_10023487 3300010375 Bacteria 6791
38 Ga0157369_10251258 3300013105 Bacteria 1845
39 Ga0157369_12138818 3300013105 Bacteria 567
40 Ga0157374_10984544 3300013296 Bacteria 862
41 Ga0163162_10001629 3300013306 Bacteria 21029
42 Ga0157372_10250408 3300013307 Bacteria 2056
43 Ga0157380_10809150 3300014326 Bacteria 955
44 Ga0157380_11332478 3300014326 Bacteria 766
45 Ga0157380_13091164 3300014326 Bacteria 531
46 Ga0157376_10011203 3300014969 Bacteria 6599
47 Ga0209050_1002133 3300025298 Bacteria 18010
48 Ga0207647_10023282 3300025904 Bacteria 4098
49 Ga0207671_10139008 3300025914 Bacteria 1870
50 Ga0207657_10032026 3300025919 Bacteria 4756
51 Ga0207659_10203233 3300025926 Bacteria 1583
52 Ga0207644_10821080 3300025931 Viruses 778
53 Ga0207690_10023209 3300025932 Bacteria 3870
54 Ga0207667_10686021 3300025949 Bacteria 1028
55 Ga0207668_11065883 3300025972 Unclassified 724
56 Ga0207703_11887146 3300026035 Unclassified 574
57 Ga0207702_10367780 3300026078 Unclassified 1380
58 Ga0207676_12410422 3300026095 Unclassified 523
59 Ga0207698_10031813 3300026142 Bacteria 3814
60 Ga0207428_10171221 3300027907 Bacteria 1644
61 Ga0268266_10009381 3300028379 Bacteria 8622
62 Ga0268266_12058444 3300028379 Unclassified 544
63 Ga0268264_10038789 3300028381 Bacteria 3933
64 Ga0265334_10017392 3300028573 Bacteria 2971
65 Ga0265327_10015083 3300031251 Bacteria 5013
66 Ga0265316_10219716 3300031344 Bacteria 1403
67 Ga0307513_10943096 3300031456 Bacteria 571
68 Ga0307509_10032682 3300031507 Bacteria 5733
69 Ga0307509_10116724 3300031507 Bacteria 2658
70 Ga0307408_100134260 3300031548 Bacteria 1934
71 Ga0307408_100681591 3300031548 Bacteria 922
72 Ga0307408_101042329 3300031548 Unclassified 756
73 Ga0265342_10282453 3300031712 Bacteria 878
74 Ga0316578_10221586 3300031728 Bacteria 1137
75 Ga0316577_10070944 3300031733 Bacteria 1944
76 Ga0316577_10747877 3300031733 Unclassified 555
77 Ga0307416_102510092 3300032002 Bacteria 614
78 Ga0307414_10000059 3300032004 Bacteria 112136
79 Ga0307414_10101701 3300032004 Bacteria 2164
80 Ga0316583_10235298 3300032133 Unclassified 635
81 Ga0316585_10022793 3300032137 Bacteria 1928
82 Ga0316585_10118106 3300032137 Bacteria 872
83 Ga0316580_10056399 3300032139 Unclassified 1208
84 Ga0373931_0540067 3300035691 Unclassified 756
85 Ga0316582_0012646 3300036647 Bacteria 4719
86 Ga0316584_0023625 3300036712 Bacteria 4492
87 Ga0395905_0000001 3300037471 Bacteria 2037079
88 Ga0395905_1309472 3300037471 Unclassified 628
89 Ga0395901_0101673 3300038443 Unclassified 3016
90 Ga0451787_182796 3300041441 Unclassified 572
91 Ga0451791_1866911 3300041451 Unclassified 824
92 Ga0451795_0756752 3300041456 Bacteria 1199
93 Ga0451795_1145300 3300041456 Unclassified 581
94 Ga0451795_1458586 3300041456 Bacteria 696
95 Ga0451795_1613565 3300041456 Bacteria 824
96 Ga0451855_0374175 3300041511 Bacteria 1531
97 Ga0466982_0036620 3300044672 Bacteria 2948
98 Ga0453684_0005137 3300044712 Bacteria 26327
99 Ga0451576_1959479 3300045051 Unclassified 604
100 Ga0495638_0000156 3300046460 Bacteria 107923
101 Ga0495632_0203443 3300046519 Bacteria 901
102 Ga0501292_124076 3300049515 Unclassified 529
103 Ga0501295_044420 3300049518 Bacteria 933
104 Ga0501300_001645 3300049523 Bacteria 3348
105 Ga0501048_1223371 3300049582 Bacteria 540
106 Ga0501068_0941916 3300049584 Bacteria 569
107 Ga0501206_004400 3300049653 Bacteria 1791
108 Ga0501207_020122 3300049654 Bacteria 1063
109 Ga0501210_002985 3300049657 Bacteria 1087
110 Ga0501217_087717 3300049661 Bacteria 870
111 Ga0501217_087797 3300049661 Unclassified 869
112 Ga0501222_001733 3300049662 Bacteria 3029
113 Ga0501222_009629 3300049662 Bacteria 1278
114 Ga0501236_013004 3300049670 Bacteria 1131
115 Ga0501242_000028 3300049674 Bacteria 9408
116 Ga0501246_012420 3300049676 Bacteria 799
117 Ga0501253_007608 3300049683 Bacteria 1521
118 Ga0501257_003360 3300049686 Unclassified 3428
119 Ga0501257_005790 3300049686 Bacteria 2733
120 Ga0501257_134680 3300049686 Bacteria 671
121 Ga0501259_004555 3300049688 Bacteria 2204
122 Ga0501225_0033917 3300049705 Bacteria 1405
123 Ga0501264_000956 3300049761 Unclassified 3576
124 nmdc:mga0qj67_518580_c1 3300050509 Bacteria 957
125 nmdc:mga08y16_152410_c1 3300050511 Unclassified 2403
126 nmdc:mga08y16_267290_c1 3300050511 Bacteria 1766
127 nmdc:mga08y16_609632_c1 3300050511 Bacteria 1100
128 Ga0500583_0523034 3300053092 Bacteria 554
129 Ga0500557_137615 3300053105 Bacteria 807
130 Ga0500562_019425 3300053108 Bacteria 1757
131 Ga0500562_049869 3300053108 Unclassified 1119
132 Ga0500562_125001 3300053108 Unclassified 701
133 Ga0500604_0001701 3300053151 Bacteria 6169
134 Ga0500616_0000082 3300053153 Bacteria 198665
135 Ga0500622_0000003 3300053156 Bacteria 613483
136 Ga0500622_0000008 3300053156 Bacteria 423636
137 Ga0500622_0000640 3300053156 Bacteria 31322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2919692658 2919694851 91
2 3300005327 Ga0070658_10950229 Ga0070658_109502291 93
3 3300032004 Ga0307414_10000059 Ga0307414_1000005924 93
4 3300032004 Ga0307414_10101701 Ga0307414_101017012 93
5 3300041456 Ga0451795_1145300 Ga0451795_1145300_249_530 93
6 3300041456 Ga0451795_1458586 Ga0451795_1458586_284_565 93
7 3300003322 rootL2_10008586 rootL2_1000858611 94
8 3300003322 rootL2_10035027 rootL2_100350273 94
9 3300003322 rootL2_10058734 rootL2_100587344 94
10 3300003322 rootL2_10214288 rootL2_102142885 94
11 3300003323 rootH1_10260401 rootH1_102604014 94
12 3300005262 Ga0065165_1002268 Ga0065165_100226817 94
13 3300005347 Ga0070668_100206711 Ga0070668_1002067111 94
14 3300005355 Ga0070671_101045268 Ga0070671_1010452682 94
15 3300005548 Ga0070665_102513616 Ga0070665_1025136162 94
16 3300005614 Ga0068856_100270758 Ga0068856_1002707583 94
17 3300005617 Ga0068859_100376443 Ga0068859_1003764433 94
18 3300005841 Ga0068863_100137728 Ga0068863_1001377283 94
19 3300005844 Ga0068862_102265841 Ga0068862_1022658411 94
20 3300006844 Ga0075428_100041734 Ga0075428_1000417347 94
21 3300006844 Ga0075428_100129618 Ga0075428_1001296185 94
22 3300006844 Ga0075428_100685550 Ga0075428_1006855502 94
23 3300006931 Ga0097620_100376443 Ga0097620_1003764433 94
24 3300009094 Ga0111539_10005387 Ga0111539_1000538711 94
25 3300009094 Ga0111539_10039936 Ga0111539_100399364 94
26 3300009545 Ga0105237_11132921 Ga0105237_111329212 94
27 3300010375 Ga0105239_10000249 Ga0105239_1000024938 94
28 3300013307 Ga0157372_10250408 Ga0157372_102504083 94
29 3300014326 Ga0157380_10809150 Ga0157380_108091502 94
30 3300025931 Ga0207644_10821080 Ga0207644_108210802 94
31 3300025972 Ga0207668_11065883 Ga0207668_110658831 94
32 3300026035 Ga0207703_11887146 Ga0207703_118871462 94
33 3300026078 Ga0207702_10367780 Ga0207702_103677803 94
34 3300026095 Ga0207676_12410422 Ga0207676_124104222 94
35 3300027907 Ga0207428_10171221 Ga0207428_101712213 94
36 3300028379 Ga0268266_12058444 Ga0268266_120584442 94
37 3300031251 Ga0265327_10015083 Ga0265327_100150837 94
38 3300031456 Ga0307513_10943096 Ga0307513_109430962 94
39 3300031507 Ga0307509_10032682 Ga0307509_100326823 94
40 3300031507 Ga0307509_10116724 Ga0307509_101167242 94
41 3300031548 Ga0307408_100134260 Ga0307408_1001342603 94
42 3300031548 Ga0307408_100681591 Ga0307408_1006815912 94
43 3300031548 Ga0307408_101042329 Ga0307408_1010423292 94
44 3300031733 Ga0316577_10747877 Ga0316577_107478771 94
45 3300032002 Ga0307416_102510092 Ga0307416_1025100922 94
46 3300041441 Ga0451787_182796 Ga0451787_182796_170_454 94
47 3300041451 Ga0451791_1866911 Ga0451791_1866911_470_754 94
48 3300041456 Ga0451795_0756752 Ga0451795_0756752_70_354 94
49 3300044672 Ga0466982_0036620 Ga0466982_0036620_2073_2357 94
50 3300046519 Ga0495632_0203443 Ga0495632_0203443_37_321 94
51 3300049515 Ga0501292_124076 Ga0501292_124076_169_453 94
52 3300049518 Ga0501295_044420 Ga0501295_044420_589_873 94
53 3300049523 Ga0501300_001645 Ga0501300_001645_1731_2015 94
54 3300049582 Ga0501048_1223371 Ga0501048_1223371_215_499 94
55 3300049653 Ga0501206_004400 Ga0501206_004400_908_1192 94
56 3300049654 Ga0501207_020122 Ga0501207_020122_700_984 94
57 3300049657 Ga0501210_002985 Ga0501210_002985_699_983 94
58 3300049661 Ga0501217_087717 Ga0501217_087717_562_846 94
59 3300049661 Ga0501217_087797 Ga0501217_087797_392_676 94
60 3300049662 Ga0501222_001733 Ga0501222_001733_2633_2917 94
61 3300049662 Ga0501222_009629 Ga0501222_009629_969_1253 94
62 3300049670 Ga0501236_013004 Ga0501236_013004_541_825 94
63 3300049674 Ga0501242_000028 Ga0501242_000028_6575_6859 94
64 3300049676 Ga0501246_012420 Ga0501246_012420_175_459 94
65 3300049683 Ga0501253_007608 Ga0501253_007608_411_695 94
66 3300049686 Ga0501257_003360 Ga0501257_003360_125_409 94
67 3300049686 Ga0501257_005790 Ga0501257_005790_952_1236 94
68 3300049686 Ga0501257_134680 Ga0501257_134680_163_447 94
69 3300049688 Ga0501259_004555 Ga0501259_004555_379_663 94
70 3300049705 Ga0501225_0033917 Ga0501225_0033917_379_663 94
71 3300049761 Ga0501264_000956 Ga0501264_000956_2693_2977 94
72 3300050509 nmdc:mga0qj67_518580_c1 nmdc:mga0qj67_518580_c1_614_898 94
73 3300050511 nmdc:mga08y16_152410_c1 nmdc:mga08y16_152410_c1_1802_2086 94
74 3300050511 nmdc:mga08y16_267290_c1 nmdc:mga08y16_267290_c1_217_501 94
75 3300050511 nmdc:mga08y16_609632_c1 nmdc:mga08y16_609632_c1_57_341 94
76 3300053092 Ga0500583_0523034 Ga0500583_0523034_89_373 94
77 3300053108 Ga0500562_125001 Ga0500562_125001_144_431 94
78 3300053156 Ga0500622_0000640 Ga0500622_0000640_2742_3035 94
79 3300003320 rootH2_10150039 rootH2_101500395 95
80 3300003322 rootL2_10064706 rootL2_100647062 95
81 3300003791 Ga0055530_10038353 Ga0055530_100383532 95
82 3300005340 Ga0070689_100140611 Ga0070689_1001406113 95
83 3300005365 Ga0070688_100098286 Ga0070688_1000982861 95
84 3300005466 Ga0070685_10007897 Ga0070685_100078976 95
85 3300005547 Ga0070693_100149162 Ga0070693_1001491622 95
86 3300005548 Ga0070665_100002830 Ga0070665_10000283018 95
87 3300005563 Ga0068855_101728488 Ga0068855_1017284882 95
88 3300005616 Ga0068852_100134653 Ga0068852_1001346534 95
89 3300005843 Ga0068860_100049105 Ga0068860_1000491055 95
90 3300006173 Ga0070716_100123470 Ga0070716_1001234701 95
91 3300006358 Ga0068871_100001922 Ga0068871_1000019225 95
92 3300009545 Ga0105237_10328046 Ga0105237_103280461 95
93 3300010375 Ga0105239_10023487 Ga0105239_100234873 95
94 3300013105 Ga0157369_10251258 Ga0157369_102512583 95
95 3300013105 Ga0157369_12138818 Ga0157369_121388182 95
96 3300013296 Ga0157374_10984544 Ga0157374_109845442 95
97 3300013306 Ga0163162_10001629 Ga0163162_1000162919 95
98 3300014326 Ga0157380_11332478 Ga0157380_113324782 95
99 3300014326 Ga0157380_13091164 Ga0157380_130911642 95
100 3300014969 Ga0157376_10011203 Ga0157376_100112033 95
101 3300025298 Ga0209050_1002133 Ga0209050_10021339 95
102 3300025904 Ga0207647_10023282 Ga0207647_100232825 95
103 3300025914 Ga0207671_10139008 Ga0207671_101390082 95
104 3300025919 Ga0207657_10032026 Ga0207657_100320265 95
105 3300025926 Ga0207659_10203233 Ga0207659_102032332 95
106 3300025932 Ga0207690_10023209 Ga0207690_100232093 95
107 3300025949 Ga0207667_10686021 Ga0207667_106860212 95
108 3300026142 Ga0207698_10031813 Ga0207698_100318133 95
109 3300028379 Ga0268266_10009381 Ga0268266_100093817 95
110 3300028381 Ga0268264_10038789 Ga0268264_100387895 95
111 3300028573 Ga0265334_10017392 Ga0265334_100173922 95
112 3300031344 Ga0265316_10219716 Ga0265316_102197162 95
113 3300031712 Ga0265342_10282453 Ga0265342_102824531 95
114 3300031728 Ga0316578_10221586 Ga0316578_102215863 95
115 3300031733 Ga0316577_10070944 Ga0316577_100709442 95
116 3300032133 Ga0316583_10235298 Ga0316583_102352981 95
117 3300032137 Ga0316585_10022793 Ga0316585_100227932 95
118 3300032137 Ga0316585_10118106 Ga0316585_101181062 95
119 3300032139 Ga0316580_10056399 Ga0316580_100563992 95
120 3300035691 Ga0373931_0540067 Ga0373931_0540067_418_717 95
121 3300036647 Ga0316582_0012646 Ga0316582_0012646_3046_3339 95
122 3300036712 Ga0316584_0023625 Ga0316584_0023625_1562_1855 95
123 3300037471 Ga0395905_0000001 Ga0395905_0000001_999642_999929 95
124 3300037471 Ga0395905_1309472 Ga0395905_1309472_133_426 95
125 3300038443 Ga0395901_0101673 Ga0395901_0101673_290_589 95
126 3300041456 Ga0451795_1613565 Ga0451795_1613565_19_309 95
127 3300041511 Ga0451855_0374175 Ga0451855_0374175_523_828 95
128 3300044712 Ga0453684_0005137 Ga0453684_0005137_8235_8522 95
129 3300045051 Ga0451576_1959479 Ga0451576_1959479_193_483 95
130 3300046460 Ga0495638_0000156 Ga0495638_0000156_94514_94801 95
131 3300049584 Ga0501068_0941916 Ga0501068_0941916_123_410 95
132 3300053105 Ga0500557_137615 Ga0500557_137615_349_636 95
133 3300053108 Ga0500562_019425 Ga0500562_019425_311_604 95
134 3300053108 Ga0500562_049869 Ga0500562_049869_414_707 95
135 3300053151 Ga0500604_0001701 Ga0500604_0001701_2907_3200 95
136 3300053153 Ga0500616_0000082 Ga0500616_0000082_108321_108608 95
137 3300053156 Ga0500622_0000003 Ga0500622_0000003_221747_222040 95
138 3300053156 Ga0500622_0000008 Ga0500622_0000008_16011_16304 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

20

99

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ub9-assembly1.cif.gz_A-2 structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 0.9591 8 92
5l9t-assembly1.cif.gz_N model of human anaphase-promoting complex/cyclosome (apc/c-cdh1) with e2 ube2s poised for polyubiquitination where ube2s, apc2, and apc11 are modeled into low resolution density 0.9321 13 56
3nrv-assembly2.cif.gz_B crystal structure of marr/emrr family transcriptional regulator from acinetobacter sp. adp1 0.9244 14 86
2mlg-assembly1.cif.gz_A stf76 from the sulfolobus islandicus plasmid-virus pssvx 0.9185 10 73
5hlh-assembly1.cif.gz_A crystal structure of the overoxidized abfr bound to dna 0.9058 14 90
ID Description Score Start End Superfamily
1ub9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9591 8 92 1.10.10.10
1u2wD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9365 8 50 1.10.10.10
af_Q57874_1_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9329 6 94 1.10.10.10
2mlgA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9185 10 73 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9146 12 57 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y5G6D1-F1-model_v4 Transcriptional regulator 1.002 5 92
AF-A0A0P6WLL8-F1-model_v4 Winged helix DNA-binding domain-containing protein 1.001 4 92
AF-A0A6G6REU5-F1-model_v4 deleted 1.001 5 89
AF-X0SUE2-F1-model_v4 Winged helix DNA-binding domain-containing protein 1.001 5 90
AF-C6XMK4-F1-model_v4 Transcriptional regulator, MarR family 1 5 92

Feature Viewer

pLDDT pTM Quality
95.42 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map