F171762

General Info

Members Datasets Scaffolds Average Seq Length
138 108 133 330

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10068291|rootH1_100682912
Length 355
Sequence VLDVLRVVVDWFQGGLNPLQGFGRGGGQEAPRTIAGMKPVETWKAVDEPSLKERLEQRAEPVLLKGLVSHWAAVQAGREPGLGICDYLHRLDRGVEVMATKTRAAARGVMGYNDDLTDFAFVKARMGLPEFMQHLAAYLPVDGAPAIAAQCAKVSDVIPGFLDENRLEALPGVVPNFWLGNALTVPVHHDHPYNLACVVAGRRRFTLFAPEQVGNLYIGPLEHTPSGAPISVVHPKSPDFERYPRWREALAAALVAELEPGDALYMPPLWFHQVEALEKVNLLINYWWPVAMLPGAKDLPAPAHALIQAIQVLNALPPAQRDAWAAMFEHYVVQREQEPAGHIPEAWRGVLARRR

Samples

Sample ID Description Type Environment
1 2643221585 Pelomonas sp. Root662 Isolate Unclassified
2 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2643221656 Pelomonas sp. Root405 Isolate Unclassified
5 2738541337 Pelomonas sp. BT06 Isolate Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
70 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
76 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
77 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
78 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
79 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
80 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
81 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
82 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
88 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
102 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
103 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
104 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
105 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
106 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
107 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
108 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 0
Isolates 3.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.74
Nodule 0
Rhizoplane 0.72
Rhizosphere 64.49
Stem 0
Stem Tuber 0
Unclassified 13.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10030177 3300003320 Bacteria 17389
2 rootH2_10130238 3300003320 Bacteria 4847
3 rootL2_10137906 3300003322 Bacteria 3766
4 rootH1_10015709 3300003323 Bacteria 2377
5 rootH1_10020162 3300003323 Bacteria 25396
6 rootH1_10065719 3300003323 Bacteria 5762
7 rootH1_10068291 3300003323 Bacteria 1500
8 rootH1_10196846 3300003323 Bacteria 1554
9 Ga0055539_1001384 3300003752 Bacteria 4599
10 Ga0055525_1000222 3300003759 Bacteria 61500
11 Ga0055526_1001375 3300003771 Bacteria 17417
12 Ga0055537_1002669 3300003773 Bacteria 5824
13 Ga0055530_10000027 3300003791 Bacteria 129838
14 Ga0055531_10000013 3300003794 Bacteria 187583
15 Ga0055531_10000513 3300003794 Bacteria 34951
16 Ga0065165_1002650 3300005262 Bacteria 14484
17 Ga0070658_10034994 3300005327 Bacteria 4044
18 Ga0070683_100022095 3300005329 Bacteria 5682
19 Ga0070690_100028801 3300005330 Bacteria 3442
20 Ga0070666_10039082 3300005335 Bacteria 3160
21 Ga0070666_10114770 3300005335 Bacteria 1865
22 Ga0070680_100328293 3300005336 Bacteria 1299
23 Ga0070713_100343651 3300005436 Bacteria 1383
24 Ga0070663_100079360 3300005455 Bacteria 2408
25 Ga0070681_10046186 3300005458 Bacteria 4355
26 Ga0070679_100023313 3300005530 Bacteria 6057
27 Ga0070665_100147834 3300005548 Bacteria 2352
28 Ga0068856_100033123 3300005614 Bacteria 5060
29 Ga0068858_100087939 3300005842 Bacteria 2890
30 Ga0097621_100004771 3300006237 Bacteria 9486
31 Ga0097621_100008848 3300006237 Bacteria 7277
32 Ga0075370_10032969 3300006353 Bacteria 2898
33 Ga0068871_100000172 3300006358 Bacteria 43437
34 Ga0068871_100008454 3300006358 Bacteria 7406
35 Ga0068871_100041887 3300006358 Bacteria 3673
36 Ga0068865_100034931 3300006881 Bacteria 3377
37 Ga0105240_10069770 3300009093 Bacteria 4349
38 Ga0105240_10093018 3300009093 Bacteria 3681
39 Ga0105242_10010028 3300009176 Bacteria 7253
40 Ga0105248_10025969 3300009177 Bacteria 6514
41 Ga0105238_10360667 3300009551 Bacteria 1443
42 Ga0105239_10227701 3300010375 Unclassified 2091
43 Ga0157374_10171893 3300013296 Bacteria 2114
44 Ga0157378_10119223 3300013297 Bacteria 2430
45 Ga0157378_10425100 3300013297 Bacteria 1314
46 Ga0163162_10046840 3300013306 Bacteria 4334
47 Ga0157375_10063268 3300013308 Bacteria 3680
48 Ga0163161_10077941 3300017792 Bacteria 2435
49 Ga0213872_10000045 3300021361 Bacteria 112229
50 Ga0213872_10000106 3300021361 Bacteria 77503
51 Ga0213872_10001196 3300021361 Bacteria 17590
52 Ga0213872_10013652 3300021361 Bacteria 3803
53 Ga0209563_100088 3300025230 Bacteria 175375
54 Ga0209677_100410 3300025253 Bacteria 25678
55 Ga0209565_1000089 3300025263 Bacteria 150511
56 Ga0209455_1007324 3300025272 Bacteria 3131
57 Ga0209050_1000014 3300025298 Bacteria 774327
58 Ga0209050_1015265 3300025298 Bacteria 3240
59 Ga0209051_1004489 3300025303 Bacteria 8580
60 Ga0209257_1000019 3300025304 Bacteria 774261
61 Ga0209257_1001107 3300025304 Bacteria 35003
62 Ga0209257_1016130 3300025304 Bacteria 3047
63 Ga0207680_10096967 3300025903 Bacteria 1887
64 Ga0207705_10185027 3300025909 Bacteria 1573
65 Ga0207707_10031703 3300025912 Bacteria 4626
66 Ga0207707_10149972 3300025912 Bacteria 2039
67 Ga0207695_10070412 3300025913 Bacteria 3575
68 Ga0207657_10115146 3300025919 Bacteria 2216
69 Ga0207700_10235361 3300025928 Bacteria 1559
70 Ga0207644_10090078 3300025931 Bacteria 2285
71 Ga0207686_10019121 3300025934 Bacteria 3890
72 Ga0207686_10051635 3300025934 Bacteria 2562
73 Ga0207704_10045737 3300025938 Bacteria 2602
74 Ga0207678_10192491 3300026067 Unclassified 1743
75 Ga0207678_10387755 3300026067 Bacteria 1208
76 Ga0207648_10005279 3300026089 Bacteria 13045
77 Ga0207683_10039887 3300026121 Bacteria 4096
78 Ga0268264_10137398 3300028381 Bacteria 2175
79 Ga0307517_10009422 3300028786 Bacteria 13832
80 Ga0307517_10150670 3300028786 Bacteria 1596
81 Ga0265338_10107241 3300028800 Bacteria 2259
82 Ga0265331_10005689 3300031250 Bacteria 7484
83 Ga0265327_10000020 3300031251 Bacteria 424552
84 Ga0307513_10065231 3300031456 Bacteria 3831
85 Ga0265314_10012254 3300031711 Bacteria 7015
86 Ga0307510_10015266 3300033180 Bacteria 9079
87 Ga0373939_0000253 3300035114 Bacteria 14474
88 Ga0373931_0000294 3300035691 Bacteria 20984
89 Ga0395905_0016707 3300037471 Bacteria 6974
90 Ga0395905_0040798 3300037471 Bacteria 4355
91 Ga0395901_0400272 3300038443 Bacteria 1411
92 Ga0436361_0152690 3300039447 Bacteria 36214
93 Ga0436361_0207523 3300039447 Bacteria 56742
94 Ga0436361_0238257 3300039447 Bacteria 2249
95 Ga0436361_0261362 3300039447 Bacteria 7457
96 Ga0436361_0937450 3300039447 Bacteria 4101
97 Ga0439436_0018672 3300041404 Bacteria 2073
98 Ga0439461_0000104 3300041410 Bacteria 11032
99 Ga0439465_0001925 3300041413 Bacteria 6808
100 Ga0439431_0000518 3300041997 Bacteria 8190
101 Ga0439445_0008894 3300042004 Bacteria 2358
102 Ga0439432_000223 3300042006 Bacteria 20460
103 Ga0439462_0001221 3300042015 Bacteria 5630
104 Ga0439434_0000659 3300042435 Bacteria 9905
105 Ga0466959_0064492 3300045049 Unclassified 2660
106 Ga0495650_0000644 3300046471 Bacteria 46276
107 Ga0495583_0001769 3300046506 Bacteria 20619
108 Ga0495587_0118858 3300046536 Bacteria 1514
109 Ga0495622_0009519 3300046557 Bacteria 4496
110 Ga0495600_0034294 3300046809 Bacteria 3294
111 Ga0496115_0001550 3300048918 Bacteria 16508
112 Ga0496126_0001566 3300048929 Bacteria 35078
113 Ga0501032_0211008 3300049569 Bacteria 1266
114 Ga0501033_0168522 3300049570 Bacteria 1573
115 Ga0501034_0086290 3300049571 Bacteria 3140
116 Ga0501046_0030056 3300049580 Bacteria 4412
117 Ga0501046_0214912 3300049580 Bacteria 1426
118 Ga0501047_0005389 3300049581 Bacteria 12024
119 Ga0501047_0181043 3300049581 Bacteria 1974
120 Ga0501073_0290426 3300049589 Bacteria 1128
121 Ga0501080_0052046 3300049742 Bacteria 3811
122 Ga0501044_0055164 3300049823 Bacteria 4082
123 nmdc:mga0k408_54943_c1 3300050493 Bacteria 2308
124 nmdc:mga07m45_3708_c1 3300050496 Bacteria 7390
125 nmdc:mga07m45_5291_c1 3300050496 Bacteria 6418
126 Ga0500635_0000032 3300053080 Bacteria 98869
127 Ga0500566_0000696 3300053094 Bacteria 18967
128 Ga0500591_037241 3300053115 Bacteria 2330
129 Ga0500593_096481 3300053117 Bacteria 1241
130 Ga0500595_000444 3300053119 Bacteria 25876
131 Ga0500573_0000015 3300053140 Bacteria 192264
132 Ga0500645_005823 3300053730 Bacteria 4478
133 Ga0500596_000132 3300053735 Bacteria 11004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10387755 Ga0207678_103877552 272
2 iso_pu_bacteria 2738541337 2739057934 297
3 3300031250 Ga0265331_10005689 Ga0265331_100056892 311
4 3300031251 Ga0265327_10000020 Ga0265327_10000020341 311
5 iso_pu_bacteria 2643221585 2643933820 311
6 iso_pu_bacteria 2643221639 2644218814 311
7 iso_pu_bacteria 2643221646 2644256995 311
8 iso_pu_bacteria 2643221656 2644315314 311
9 3300003322 rootL2_10137906 rootL2_101379061 315
10 3300003323 rootH1_10015709 rootH1_100157092 315
11 3300003323 rootH1_10196846 rootH1_101968462 315
12 3300003759 Ga0055525_1000222 Ga0055525_10002227 315
13 3300003794 Ga0055531_10000513 Ga0055531_100005138 315
14 3300005262 Ga0065165_1002650 Ga0065165_100265011 315
15 3300006353 Ga0075370_10032969 Ga0075370_100329692 315
16 3300021361 Ga0213872_10000045 Ga0213872_100000453 315
17 3300021361 Ga0213872_10000106 Ga0213872_1000010627 315
18 3300021361 Ga0213872_10001196 Ga0213872_100011967 315
19 3300021361 Ga0213872_10013652 Ga0213872_100136523 315
20 3300025230 Ga0209563_100088 Ga0209563_100088117 315
21 3300025303 Ga0209051_1004489 Ga0209051_10044892 315
22 3300025304 Ga0209257_1001107 Ga0209257_10011078 315
23 3300025304 Ga0209257_1016130 Ga0209257_10161302 315
24 3300035114 Ga0373939_0000253 Ga0373939_0000253_10232_11191 315
25 3300035691 Ga0373931_0000294 Ga0373931_0000294_17246_18205 315
26 3300037471 Ga0395905_0016707 Ga0395905_0016707_4834_5784 315
27 3300039447 Ga0436361_0152690 Ga0436361_0152690_438_1388 315
28 3300039447 Ga0436361_0207523 Ga0436361_0207523_49262_50212 315
29 3300039447 Ga0436361_0238257 Ga0436361_0238257_1035_1988 315
30 3300039447 Ga0436361_0261362 Ga0436361_0261362_5555_6514 315
31 3300039447 Ga0436361_0937450 Ga0436361_0937450_2034_2984 315
32 3300050493 nmdc:mga0k408_54943_c1 nmdc:mga0k408_54943_c1_1102_2052 315
33 3300050496 nmdc:mga07m45_3708_c1 nmdc:mga07m45_3708_c1_2028_2987 315
34 3300050496 nmdc:mga07m45_5291_c1 nmdc:mga07m45_5291_c1_906_1865 315
35 3300048918 Ga0496115_0001550 Ga0496115_0001550_9716_10702 317
36 3300049571 Ga0501034_0086290 Ga0501034_0086290_1605_2609 321
37 3300049580 Ga0501046_0030056 Ga0501046_0030056_144_1148 321
38 3300049581 Ga0501047_0005389 Ga0501047_0005389_9373_10377 321
39 3300049742 Ga0501080_0052046 Ga0501080_0052046_2342_3346 321
40 3300003771 Ga0055526_1001375 Ga0055526_10013755 324
41 3300003773 Ga0055537_1002669 Ga0055537_10026692 324
42 3300005530 Ga0070679_100023313 Ga0070679_1000233135 324
43 3300025263 Ga0209565_1000089 Ga0209565_100008959 324
44 3300025298 Ga0209050_1015265 Ga0209050_10152652 324
45 3300053094 Ga0500566_0000696 Ga0500566_0000696_13251_14246 324
46 3300053115 Ga0500591_037241 Ga0500591_037241_487_1473 324
47 3300053140 Ga0500573_0000015 Ga0500573_0000015_125823_126809 324
48 3300006881 Ga0068865_100034931 Ga0068865_1000349313 326
49 3300049570 Ga0501033_0168522 Ga0501033_0168522_227_1222 326
50 3300049580 Ga0501046_0214912 Ga0501046_0214912_302_1297 326
51 3300049581 Ga0501047_0181043 Ga0501047_0181043_121_1116 326
52 3300003323 rootH1_10068291 rootH1_100682912 327
53 3300003791 Ga0055530_10000027 Ga0055530_1000002722 328
54 3300003794 Ga0055531_10000013 Ga0055531_10000013141 328
55 3300005330 Ga0070690_100028801 Ga0070690_1000288012 328
56 3300005335 Ga0070666_10039082 Ga0070666_100390822 328
57 3300005842 Ga0068858_100087939 Ga0068858_1000879392 328
58 3300006358 Ga0068871_100008454 Ga0068871_1000084542 328
59 3300009093 Ga0105240_10069770 Ga0105240_100697702 328
60 3300009177 Ga0105248_10025969 Ga0105248_100259693 328
61 3300009551 Ga0105238_10360667 Ga0105238_103606671 328
62 3300013296 Ga0157374_10171893 Ga0157374_101718931 328
63 3300013297 Ga0157378_10119223 Ga0157378_101192232 328
64 3300013308 Ga0157375_10063268 Ga0157375_100632683 328
65 3300017792 Ga0163161_10077941 Ga0163161_100779413 328
66 3300025298 Ga0209050_1000014 Ga0209050_100001422 328
67 3300025304 Ga0209257_1000019 Ga0209257_1000019670 328
68 3300025931 Ga0207644_10090078 Ga0207644_100900782 328
69 3300025934 Ga0207686_10051635 Ga0207686_100516352 328
70 3300025938 Ga0207704_10045737 Ga0207704_100457372 328
71 3300026089 Ga0207648_10005279 Ga0207648_100052797 328
72 3300026121 Ga0207683_10039887 Ga0207683_100398874 328
73 3300028381 Ga0268264_10137398 Ga0268264_101373982 328
74 3300003323 rootH1_10065719 rootH1_100657195 329
75 3300005335 Ga0070666_10114770 Ga0070666_101147702 329
76 3300005548 Ga0070665_100147834 Ga0070665_1001478342 329
77 3300005614 Ga0068856_100033123 Ga0068856_1000331232 329
78 3300006237 Ga0097621_100004771 Ga0097621_1000047712 329
79 3300006237 Ga0097621_100008848 Ga0097621_1000088487 329
80 3300006358 Ga0068871_100000172 Ga0068871_1000001722 329
81 3300006358 Ga0068871_100041887 Ga0068871_1000418872 329
82 3300009176 Ga0105242_10010028 Ga0105242_100100284 329
83 3300013297 Ga0157378_10425100 Ga0157378_104251001 329
84 3300025903 Ga0207680_10096967 Ga0207680_100969672 329
85 3300025909 Ga0207705_10185027 Ga0207705_101850272 329
86 3300025919 Ga0207657_10115146 Ga0207657_101151462 329
87 3300025934 Ga0207686_10019121 Ga0207686_100191213 329
88 3300049569 Ga0501032_0211008 Ga0501032_0211008_139_1143 329
89 3300049589 Ga0501073_0290426 Ga0501073_0290426_84_1088 329
90 3300049823 Ga0501044_0055164 Ga0501044_0055164_2495_3499 329
91 3300053117 Ga0500593_096481 Ga0500593_096481_193_1194 329
92 3300013306 Ga0163162_10046840 Ga0163162_100468402 330
93 3300025272 Ga0209455_1007324 Ga0209455_10073242 330
94 3300028786 Ga0307517_10009422 Ga0307517_1000942214 330
95 3300028786 Ga0307517_10150670 Ga0307517_101506702 330
96 3300031456 Ga0307513_10065231 Ga0307513_100652314 330
97 3300033180 Ga0307510_10015266 Ga0307510_100152663 330
98 3300037471 Ga0395905_0040798 Ga0395905_0040798_18_1022 330
99 3300046471 Ga0495650_0000644 Ga0495650_0000644_8354_9358 330
100 3300046506 Ga0495583_0001769 Ga0495583_0001769_19001_20005 330
101 3300046536 Ga0495587_0118858 Ga0495587_0118858_68_1072 330
102 3300046557 Ga0495622_0009519 Ga0495622_0009519_3059_4063 330
103 3300046809 Ga0495600_0034294 Ga0495600_0034294_126_1130 330
104 3300053119 Ga0500595_000444 Ga0500595_000444_24793_25797 330
105 3300053730 Ga0500645_005823 Ga0500645_005823_929_1933 330
106 3300053735 Ga0500596_000132 Ga0500596_000132_1831_2835 330
107 3300005436 Ga0070713_100343651 Ga0070713_1003436512 331
108 3300009093 Ga0105240_10093018 Ga0105240_100930182 331
109 3300010375 Ga0105239_10227701 Ga0105239_102277012 331
110 3300025913 Ga0207695_10070412 Ga0207695_100704123 331
111 3300025928 Ga0207700_10235361 Ga0207700_102353612 331
112 3300048929 Ga0496126_0001566 Ga0496126_0001566_94_1104 331
113 3300005327 Ga0070658_10034994 Ga0070658_100349943 332
114 3300005329 Ga0070683_100022095 Ga0070683_1000220956 332
115 3300005336 Ga0070680_100328293 Ga0070680_1003282931 332
116 3300005455 Ga0070663_100079360 Ga0070663_1000793602 332
117 3300005458 Ga0070681_10046186 Ga0070681_100461862 332
118 3300025912 Ga0207707_10031703 Ga0207707_100317032 332
119 3300025912 Ga0207707_10149972 Ga0207707_101499723 332
120 3300026067 Ga0207678_10192491 Ga0207678_101924912 332
121 3300028800 Ga0265338_10107241 Ga0265338_101072412 332
122 3300041404 Ga0439436_0018672 Ga0439436_0018672_709_1731 332
123 3300041410 Ga0439461_0000104 Ga0439461_0000104_2650_3672 332
124 3300041413 Ga0439465_0001925 Ga0439465_0001925_1234_2256 332
125 3300041997 Ga0439431_0000518 Ga0439431_0000518_6585_7607 332
126 3300042004 Ga0439445_0008894 Ga0439445_0008894_145_1167 332
127 3300042006 Ga0439432_000223 Ga0439432_000223_11994_13016 332
128 3300042015 Ga0439462_0001221 Ga0439462_0001221_1445_2467 332
129 3300042435 Ga0439434_0000659 Ga0439434_0000659_1727_2749 332
130 3300045049 Ga0466959_0064492 Ga0466959_0064492_76_1092 332
131 3300003323 rootH1_10020162 rootH1_100201627 333
132 3300003752 Ga0055539_1001384 Ga0055539_10013842 333
133 3300031711 Ga0265314_10012254 Ga0265314_100122544 333
134 3300038443 Ga0395901_0400272 Ga0395901_0400272_297_1307 333
135 3300053080 Ga0500635_0000032 Ga0500635_0000032_22964_24025 334
136 3300025253 Ga0209677_100410 Ga0209677_1004104 336
137 3300003320 rootH2_10130238 rootH2_101302381 339
138 3300003320 rootH2_10030177 rootH2_100301775 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13621

Cupin_8

Cupin-like domain

49

292

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.902 154 265
6xcv-assembly1.cif.gz_A crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8666 154 265
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.866 154 265
6m9r-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.8655 154 265
6m9r-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.8652 154 265
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9134 154 267 2.60.120.10
3gbfA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8588 153 268 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8571 153 267 2.60.120.10
af_A0A0R0L748_60_231_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8434 156 263 2.60.120.10
af_Q9W0M3_161_400_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8421 17 267 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A844ZDL4-F1-model_v4 Cupin-like domain-containing protein 0.9801 15 237
AF-M4RL96-F1-model_v4 Transcription factor jumonji jmjC domain-containing protein 0.9769 167 247
AF-A0A519HEC8-F1-model_v4 Cupin-like domain-containing protein 0.9744 14 195
AF-A0A2G4K4S1-F1-model_v4 Peptidylprolyl isomerase 0.9708 17 347 GO:0016853
AF-A0A5S3YL44-F1-model_v4 JmjC domain-containing protein 0.969 155 262

Feature Viewer

pLDDT pTM Quality
90.65 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map