F169586

General Info

Members Datasets Scaffolds Average Seq Length
137 111 274 348

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10005969|Ga0105240_1000596910
Length 366
Sequence MTHVLLVRKRQIMLQETMEPAWLDAFEAVFTRCALKRGDIVVVLAESQSRPVLAQLAHLAAARMGCKCFAITVPTVFEAGPAVRSTGASTALQQLVPVISALASSTLVVDCTVEGLMHSPELPAVLKGGARVLYVSNEHPEALARLVPDDSLEPLVKDHVKRLRSARVMRVTSAAGTDLDISLAGATCGGNWGYTSRPGTITHWPGGLALAFPGAGSVNGTLVLAEGDVNLTFKRYIERPITLRIENDYITSIEGAGIDADLMRSYIAAWGDGGGDAATASGRDAYAVSHVGYGLNAAARWDSMALYDKRDFNGTELRAFAGNFLYSTGANEVAGRYTRGHFDLPLRNCTVALDGATVVEAGKLLA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
4 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
5 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
14 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
15 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
35 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
36 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
42 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
43 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
44 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
45 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
46 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
47 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
54 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
57 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
58 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
61 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
62 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
63 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
73 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
83 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
84 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
97 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
104 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
105 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
106 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
107 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
108 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
110 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
111 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.22
Nodule 0
Rhizoplane 0
Rhizosphere 77.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10005969 3300009093 Bacteria 18019
2 Ga0068868_100014051 3300005338 Bacteria 5892
3 Ga0070694_100093962 3300005444 Bacteria 2109
4 Ga0070679_100022910 3300005530 Bacteria 6109
5 Ga0070679_100199586 3300005530 Bacteria 1967
6 Ga0070697_100296301 3300005536 Bacteria 1390
7 Ga0068855_100148311 3300005563 Bacteria 2669
8 Ga0068856_100042041 3300005614 Bacteria 4495
9 Ga0068861_100032813 3300005719 Bacteria 3826
10 Ga0081455_10029783 3300005937 Bacteria 4972
11 Ga0075365_10004735 3300006038 Bacteria 7254
12 Ga0075365_10089490 3300006038 Bacteria 2095
13 Ga0075365_10186835 3300006038 Bacteria 1449
14 Ga0075363_100134501 3300006048 Bacteria 1389
15 Ga0075364_10138553 3300006051 Bacteria 1635
16 Ga0070716_100232689 3300006173 Bacteria 1245
17 Ga0075362_10025248 3300006177 Bacteria 2528
18 Ga0075366_10149468 3300006195 Bacteria 1414
19 Ga0075428_100025829 3300006844 Bacteria 6504
20 Ga0075433_10004604 3300006852 Bacteria 10761
21 Ga0075434_100011858 3300006871 Bacteria 8237
22 Ga0075435_100016950 3300007076 Bacteria 5500
23 Ga0111539_10059165 3300009094 Bacteria 4545
24 Ga0111539_10141417 3300009094 Bacteria 2817
25 Ga0213874_10001900 3300021377 Bacteria 4394
26 Ga0213876_10001576 3300021384 Bacteria 14013
27 Ga0213875_10000931 3300021388 Bacteria 21099
28 Ga0209130_1016084 3300025284 Bacteria 1822
29 Ga0207654_10032524 3300025911 Bacteria 2883
30 Ga0207662_10068853 3300025918 Bacteria 2138
31 Ga0207657_10036263 3300025919 Bacteria 4415
32 Ga0207652_10161383 3300025921 Bacteria 2010
33 Ga0207689_10345842 3300025942 Bacteria 1236
34 Ga0207667_10047862 3300025949 Bacteria 4523
35 Ga0207668_10010235 3300025972 Bacteria 5662
36 Ga0207677_10001620 3300026023 Bacteria 11948
37 Ga0207675_100050075 3300026118 Bacteria 3898
38 Ga0207428_10044109 3300027907 Bacteria 3598
39 Ga0307515_10000022 3300028794 Bacteria 404064
40 Ga0307515_10000417 3300028794 Bacteria 102343
41 Ga0307515_10026348 3300028794 Bacteria 10014
42 Ga0307511_10001018 3300030521 Bacteria 29761
43 Ga0265327_10036145 3300031251 Bacteria 2719
44 Ga0265316_10269840 3300031344 Bacteria 1245
45 Ga0307513_10005893 3300031456 Bacteria 16089
46 Ga0316576_10170680 3300031727 Bacteria 1642
47 Ga0307516_10298242 3300031730 Bacteria 1288
48 Ga0373948_0003181 3300034817 Bacteria 2504
49 Ga0373938_0012938 3300034957 Bacteria 1575
50 Ga0373932_0011785 3300035112 Bacteria 2143
51 Ga0373962_0001673 3300035242 Bacteria 5266
52 Ga0373924_0010092 3300035410 Bacteria 3476
53 Ga0395899_0022590 3300037312 Bacteria 4765
54 Ga0395900_0014556 3300037418 Bacteria 8026
55 Ga0395900_0276325 3300037418 Bacteria 1673
56 Ga0395898_0014217 3300037466 Bacteria 8183
57 Ga0395898_0026097 3300037466 Bacteria 5882
58 Ga0395905_0000078 3300037471 Bacteria 161593
59 Ga0395905_0000722 3300037471 Bacteria 43605
60 Ga0395905_0028021 3300037471 Bacteria 5310
61 Ga0395905_0031329 3300037471 Bacteria 5006
62 Ga0436364_0073909 3300037853 Bacteria 9825
63 Ga0395901_0011050 3300038443 Bacteria 9147
64 Ga0395901_0029857 3300038443 Bacteria 5614
65 Ga0395901_0204327 3300038443 Bacteria 2070
66 Ga0400485_02118 3300038735 Bacteria 2632
67 Ga0400485_15119 3300038735 Bacteria 5953
68 Ga0400483_069115 3300039062 Bacteria 3017
69 Ga0400483_187004 3300039062 Bacteria 10122
70 Ga0436365_0256244 3300039437 Bacteria 18770
71 Ga0436365_1205463 3300039437 Bacteria 1170
72 Ga0436363_1650454 3300039450 Bacteria 6186
73 Ga0436362_0210731 3300039453 Bacteria 7096
74 Ga0436362_0901806 3300039453 Bacteria 1999
75 Ga0439453_0016922 3300041408 Bacteria 1276
76 Ga0439449_0002495 3300042007 Bacteria 7194
77 Ga0450897_001809 3300042128 Bacteria 1516
78 Ga0450898_021664 3300042134 Bacteria 1133
79 Ga0439434_0017560 3300042435 Bacteria 2141
80 Ga0450893_0005972 3300042532 Bacteria 1963
81 Ga0451577_0018360 3300042876 Bacteria 6445
82 Ga0451577_0226557 3300042876 Bacteria 1690
83 Ga0466969_0006676 3300044656 Bacteria 6132
84 Ga0466969_0073415 3300044656 Bacteria 1642
85 Ga0466965_0148452 3300044683 Bacteria 1224
86 Ga0466968_0115923 3300044735 Bacteria 1208
87 Ga0466970_0110494 3300044765 Bacteria 1501
88 Ga0466959_0020758 3300045049 Bacteria 4840
89 Ga0451576_0083650 3300045051 Bacteria 3319
90 Ga0451576_0139298 3300045051 Bacteria 2531
91 Ga0495603_0028126 3300046455 Bacteria 3391
92 Ga0495650_0015501 3300046471 Bacteria 3905
93 Ga0501031_0027186 3300049568 Bacteria 3730
94 Ga0501032_0028672 3300049569 Bacteria 3824
95 Ga0501036_0035763 3300049572 Bacteria 4203
96 Ga0501040_0069620 3300049576 Bacteria 2427
97 Ga0501041_0229253 3300049577 Bacteria 1166
98 Ga0501043_0072746 3300049579 Bacteria 2700
99 Ga0501046_0002711 3300049580 Bacteria 16484
100 Ga0501046_0012741 3300049580 Bacteria 7153
101 Ga0501047_0019007 3300049581 Bacteria 6592
102 Ga0501048_0068409 3300049582 Bacteria 2508
103 Ga0501048_0235607 3300049582 Bacteria 1299
104 Ga0501068_0044857 3300049584 Bacteria 2663
105 Ga0501069_0010942 3300049585 Bacteria 4809
106 Ga0501070_0014725 3300049586 Bacteria 6581
107 Ga0501071_0059876 3300049587 Bacteria 2756
108 Ga0501071_0172771 3300049587 Bacteria 1618
109 Ga0501073_0021634 3300049589 Bacteria 4634
110 Ga0501074_0058760 3300049590 Bacteria 2770
111 Ga0501075_0069529 3300049591 Bacteria 2661
112 Ga0501079_0174384 3300049741 Bacteria 1677
113 Ga0501080_0064349 3300049742 Bacteria 3411
114 Ga0501081_0094935 3300049743 Bacteria 2102
115 Ga0501083_0219845 3300049744 Bacteria 1238
116 Ga0501035_0030002 3300049822 Bacteria 4959
117 Ga0501035_0064848 3300049822 Bacteria 3245
118 Ga0501044_0180858 3300049823 Bacteria 2075
119 Ga0501045_0083538 3300049824 Bacteria 2356
120 nmdc:mga0yw44_82412_c1 3300050492 Bacteria 2018
121 nmdc:mga0k408_125616_c1 3300050493 Bacteria 1521
122 nmdc:mga09592_408459_c1 3300050508 Bacteria 1173
123 nmdc:mga0qj67_102017_c1 3300050509 Bacteria 2313
124 nmdc:mga06r32_110772_c1 3300050510 Bacteria 2701
125 nmdc:mga08y16_40051_c1 3300050511 Bacteria 4913
126 nmdc:mga0n895_43133_c1 3300050512 Bacteria 4394
127 nmdc:mga0rr50_48710_c1 3300050513 Bacteria 3133
128 Ga0500646_0000819 3300053090 Bacteria 8616
129 Ga0500583_0059480 3300053092 Bacteria 1799
130 Ga0500604_0000839 3300053151 Bacteria 8489
131 Ga0500616_0007236 3300053153 Bacteria 7088
132 Ga0501084_0048559 3300054114 Bacteria 3553
133 Ga0501084_0123769 3300054114 Bacteria 2175
134 Ga0501082_0013620 3300060353 Bacteria 6989
135 Ga0501082_0058941 3300060353 Bacteria 3309
136 Ga0530510_0063138 3300061734 Bacteria 2682
137 2883579600 2883577096 Bacteria 4709178
138 Ga0105240_10005969
139 Ga0068868_100014051
140 Ga0070694_100093962
141 Ga0070679_100022910
142 Ga0070679_100199586
143 Ga0070697_100296301
144 Ga0068855_100148311
145 Ga0068856_100042041
146 Ga0068861_100032813
147 Ga0081455_10029783
148 Ga0075365_10004735
149 Ga0075365_10089490
150 Ga0075365_10186835
151 Ga0075363_100134501
152 Ga0075364_10138553
153 Ga0070716_100232689
154 Ga0075362_10025248
155 Ga0075366_10149468
156 Ga0075428_100025829
157 Ga0075433_10004604
158 Ga0075434_100011858
159 Ga0075435_100016950
160 Ga0111539_10059165
161 Ga0111539_10141417
162 Ga0213874_10001900
163 Ga0213876_10001576
164 Ga0213875_10000931
165 Ga0209130_1016084
166 Ga0207654_10032524
167 Ga0207662_10068853
168 Ga0207657_10036263
169 Ga0207652_10161383
170 Ga0207689_10345842
171 Ga0207667_10047862
172 Ga0207668_10010235
173 Ga0207677_10001620
174 Ga0207675_100050075
175 Ga0207428_10044109
176 Ga0307515_10000022
177 Ga0307515_10000417
178 Ga0307515_10026348
179 Ga0307511_10001018
180 Ga0265327_10036145
181 Ga0265316_10269840
182 Ga0307513_10005893
183 Ga0316576_10170680
184 Ga0307516_10298242
185 Ga0373948_0003181
186 Ga0373938_0012938
187 Ga0373932_0011785
188 Ga0373962_0001673
189 Ga0373924_0010092
190 Ga0395899_0022590
191 Ga0395900_0014556
192 Ga0395900_0276325
193 Ga0395898_0014217
194 Ga0395898_0026097
195 Ga0395905_0000078
196 Ga0395905_0000722
197 Ga0395905_0028021
198 Ga0395905_0031329
199 Ga0436364_0073909
200 Ga0395901_0011050
201 Ga0395901_0029857
202 Ga0395901_0204327
203 Ga0400485_02118
204 Ga0400485_15119
205 Ga0400483_069115
206 Ga0400483_187004
207 Ga0436365_0256244
208 Ga0436365_1205463
209 Ga0436363_1650454
210 Ga0436362_0210731
211 Ga0436362_0901806
212 Ga0439453_0016922
213 Ga0439449_0002495
214 Ga0450897_001809
215 Ga0450898_021664
216 Ga0439434_0017560
217 Ga0450893_0005972
218 Ga0451577_0018360
219 Ga0451577_0226557
220 Ga0466969_0006676
221 Ga0466969_0073415
222 Ga0466965_0148452
223 Ga0466968_0115923
224 Ga0466970_0110494
225 Ga0466959_0020758
226 Ga0451576_0083650
227 Ga0451576_0139298
228 Ga0495603_0028126
229 Ga0495650_0015501
230 Ga0501031_0027186
231 Ga0501032_0028672
232 Ga0501036_0035763
233 Ga0501040_0069620
234 Ga0501041_0229253
235 Ga0501043_0072746
236 Ga0501046_0002711
237 Ga0501046_0012741
238 Ga0501047_0019007
239 Ga0501048_0068409
240 Ga0501048_0235607
241 Ga0501068_0044857
242 Ga0501069_0010942
243 Ga0501070_0014725
244 Ga0501071_0059876
245 Ga0501071_0172771
246 Ga0501073_0021634
247 Ga0501074_0058760
248 Ga0501075_0069529
249 Ga0501079_0174384
250 Ga0501080_0064349
251 Ga0501081_0094935
252 Ga0501083_0219845
253 Ga0501035_0030002
254 Ga0501035_0064848
255 Ga0501044_0180858
256 Ga0501045_0083538
257 nmdc:mga0yw44_82412_c1
258 nmdc:mga0k408_125616_c1
259 nmdc:mga09592_408459_c1
260 nmdc:mga0qj67_102017_c1
261 nmdc:mga06r32_110772_c1
262 nmdc:mga08y16_40051_c1
263 nmdc:mga0n895_43133_c1
264 nmdc:mga0rr50_48710_c1
265 Ga0500646_0000819
266 Ga0500583_0059480
267 Ga0500604_0000839
268 Ga0500616_0007236
269 Ga0501084_0048559
270 Ga0501084_0123769
271 Ga0501082_0013620
272 Ga0501082_0058941
273 Ga0530510_0063138
274 2883579600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cup-assembly1.cif.gz_F structure of 2,5-dihydroxypridine dioxygenase from pseudomonas putida kt2440 0.9386 6 345
7cup-assembly1.cif.gz_F structure of 2,5-dihydroxypridine dioxygenase from pseudomonas putida kt2440 0.9228 6 345
7wew-assembly1.cif.gz_A structure of adenylation domain of epsilon-poly-l-lysine synthase 0.866 10 61
3t66-assembly1.cif.gz_A crystal structure of nickel abc transporter from bacillus halodurans 0.7822 29 65
7dq5-assembly1.cif.gz_B crystal structure of hitb in complex with (s)-beta-phenylalanine sulfamoyladenosine 0.7693 12 99
ID Description Score Start End Superfamily
af_Q54YU1_37_192_3.40.50.980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9113 11 60 3.40.50.980
af_Q9C7W4_6_145_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.8784 11 61 3.30.300.30
af_Q9VLL0_21_432_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.8385 11 60 3.40.50.12780
af_Q4D757_69_185_3.40.50.980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7956 11 61 3.40.50.980
3t66A02 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.7822 29 65 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A4Q5UMW8-F1-model_v4 deleted 0.9977 118 344
AF-A0A529GLE1-F1-model_v4 Peptidase M29 0.9944 194 345 GO:0046872
AF-A0A7X4EPY1-F1-model_v4 deleted 0.994 159 345
AF-A0A4Q5UMW8-F1-model_v4 deleted 0.9933 118 344
AF-A0A436WKD0-F1-model_v4 Peptidase M29 0.9927 183 345 GO:0046872

Map