F169581

General Info

Members Datasets Scaffolds Average Seq Length
137 105 70 444

Family's Representative Sequence

Representative Sequence 3300009092|Ga0105250_10015696|Ga0105250_100156961
Length 471
Sequence MTNDSKNNIVSNRKLKISVAGTGYVGLVAGVCFAEVGHQVTCVDIDEKKVDLMKSGVSPIYEADLEELMQKNYAAGRINYTTDYKSAYKDADAIFIGVGTPEQADGSANLSYIATVAKQIAESIEKDCLVVVKSTVPIGTNDKVEQFIQDFLVNDVRVEVASNPEFLAQGSAVHDTLYAERIVIGTESKWAEEVLMKLYKPFHLPIVSVNRRSAEMIKYASNDFLALKISYMNDIANLCELVGADIQDVAKGMSFDERIGSKFLNAGIGFGGSCFPKDTKALEYLARQNGYELRTVKAAIDVNKDQKTLLYKKASQRLITFNGLKVAVLGLTFKPGTDDLREAASLENIPLLLEQGADIYAFDPVGANNFAKVYPEGKNKNGNITYVMDVEKALEDANVCFIFTEWGEVKALTPEVYKNLMRTPLIYDGRNIYDVQVMQEVGIEYHSIGRKSTNRERTMKELKNIELQASR

Samples

Sample ID Description Type Environment
1 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
2 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
3 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
4 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
5 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
6 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
7 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
8 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
9 2684622632 Bacillus cereus 905 Isolate Unclassified
10 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
11 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
12 2738541295 Bacillus sp. OK085 Isolate Unclassified
13 2738541358 Bacillus sp. OV752 Isolate Unclassified
14 2738543006 Bacillus sp. OK077 Isolate Unclassified
15 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
16 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
17 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
18 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
19 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
20 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
21 2818991441 Niallia circulans 3243 Isolate Rhizosphere
22 2818991459 Paenibacillus sp. 597 Isolate Unclassified
23 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
24 2842882022 Bacillus sp. R-71893 Isolate Unclassified
25 2849139964 Bacillus sp. R-71875 Isolate Unclassified
26 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
27 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
28 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
29 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
30 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
31 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
32 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
33 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
34 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
35 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
36 2929004312 Priestia megaterium 1104 Isolate Unclassified
37 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
38 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
39 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
40 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
41 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
42 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
43 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
44 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
45 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
46 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
47 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
48 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
49 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
50 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
51 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
52 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
53 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
54 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
55 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
69 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
70 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
71 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
84 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
85 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
88 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
92 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
93 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
98 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
99 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
100 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
101 8023444577 Bacillus sp. BH32 Isolate Unclassified
102 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
103 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
104 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
105 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 50.36
Metatranscriptomes 0.73
Isolates 48.91

Biome Distribution

Category Percentage (%)
Aerial Root 1.46
Bulb 0
Endosphere 8.76
Nodule 9.49
Rhizoplane 2.19
Rhizosphere 43.07
Stem 0
Stem Tuber 0
Unclassified 35.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1004006 3300002987 Bacteria 5013
2 JGI25151J46595_10028376 3300003187 Bacteria 2230
3 Ga0070698_100025992 3300005471 Bacteria 6099
4 Ga0075365_10000031 3300006038 Bacteria 56060
5 Ga0079104_1000246 3300006946 Bacteria 72294
6 Ga0079104_1000627 3300006946 Bacteria 34512
7 Ga0079104_1000657 3300006946 Bacteria 32937
8 Ga0079104_1001164 3300006946 Bacteria 19032
9 Ga0079104_1005118 3300006946 Bacteria 5336
10 Ga0105250_10015696 3300009092 Bacteria 3100
11 Ga0105243_10172064 3300009148 Bacteria 1877
12 Ga0157371_10001774 3300013102 Bacteria 21813
13 Ga0209566_100171 3300025225 Bacteria 70657
14 Ga0209566_100198 3300025225 Bacteria 62276
15 Ga0209130_1000802 3300025284 Bacteria 26664
16 Ga0209025_1001453 3300025294 Bacteria 31072
17 Ga0209025_1002967 3300025294 Bacteria 16852
18 Ga0209025_1006901 3300025294 Bacteria 8654
19 Ga0209025_1012665 3300025294 Bacteria 5382
20 Ga0209025_1041693 3300025294 Bacteria 1961
21 Ga0207696_1022775 3300025711 Bacteria 1985
22 Ga0207709_10120758 3300025935 Bacteria 1769
23 Ga0209281_1000052 3300027111 Bacteria 314741
24 Ga0209281_1000088 3300027111 Bacteria 245908
25 Ga0209281_1000198 3300027111 Bacteria 136459
26 Ga0209281_1000235 3300027111 Bacteria 115011
27 Ga0209281_1000323 3300027111 Bacteria 84095
28 Ga0209281_1012869 3300027111 Bacteria 1823
29 Ga0209281_1015103 3300027111 Bacteria 1616
30 Ga0209371_1002331 3300027312 Bacteria 10803
31 Ga0311000_115739 3300029272 Unclassified 1567
32 Ga0237817_10002 3300030083 Bacteria 100594
33 Ga0268256_1001680 3300030500 Bacteria 12654
34 Ga0316578_10042601 3300031728 Bacteria 2633
35 Ga0395899_0007512 3300037312 Bacteria 8423
36 Ga0395900_0022427 3300037418 Bacteria 6457
37 Ga0395900_0129902 3300037418 Bacteria 2582
38 Ga0395898_0024364 3300037466 Bacteria 6103
39 Ga0395901_0045148 3300038443 Bacteria 4571
40 Ga0237819_00043 3300038705 Bacteria 43866
41 Ga0453684_0007481 3300044712 Bacteria 20048
42 Ga0453684_0010870 3300044712 Bacteria 15426
43 Ga0453684_0134004 3300044712 Unclassified 2969
44 Ga0466959_0030304 3300045049 Bacteria 4006
45 Ga0466959_0042073 3300045049 Bacteria 3371
46 Ga0466967_0002852 3300045976 Bacteria 10978
47 Ga0495620_0026918 3300046515 Bacteria 2698
48 Ga0495620_0030999 3300046515 Bacteria 2454
49 Ga0495654_0098226 3300046530 Bacteria 1351
50 Ga0495672_0005406 3300047320 Bacteria 10143
51 Ga0496116_0000653 3300048919 Bacteria 45328
52 Ga0496116_0058607 3300048919 Bacteria 2509
53 Ga0496116_0067516 3300048919 Bacteria 2283
54 Ga0496116_0078718 3300048919 Bacteria 2054
55 Ga0496116_0146212 3300048919 Bacteria 1321
56 Ga0496118_0057058 3300048921 Bacteria 2930
57 Ga0496119_0024915 3300048922 Bacteria 4192
58 Ga0496120_0022374 3300048923 Bacteria 3977
59 Ga0496121_0017988 3300048924 Bacteria 7162
60 Ga0496121_0099893 3300048924 Bacteria 2241
61 Ga0496121_0152066 3300048924 Bacteria 1702
62 Ga0496122_0066716 3300048925 Bacteria 2597
63 Ga0496123_0034609 3300048926 Bacteria 3614
64 Ga0496124_0001361 3300048927 Bacteria 36625
65 Ga0496125_0001931 3300048928 Bacteria 28332
66 Ga0496125_0002101 3300048928 Bacteria 26744
67 Ga0501034_0000433 3300049571 Bacteria 69421
68 Ga0501036_0005103 3300049572 Bacteria 10620
69 Ga0501047_0081153 3300049581 Bacteria 3118
70 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0146212 Ga0496116_0146212_24_1262 398
2 3300006038 Ga0075365_10000031 Ga0075365_1000003129 407
3 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_501568_502881 407
4 iso_pu_bacteria 8054465665 8054470524 428
5 3300044712 Ga0453684_0134004 Ga0453684_0134004_26_1315 429
6 3300031728 Ga0316578_10042601 Ga0316578_100426012 430
7 3300048925 Ga0496122_0066716 Ga0496122_0066716_912_2204 430
8 iso_pu_bacteria 8007375930 8007378274 430
9 3300029272 Ga0311000_115739 Ga0311000_1157391 431
10 3300009148 Ga0105243_10172064 Ga0105243_101720642 432
11 3300013102 Ga0157371_10001774 Ga0157371_1000177422 432
12 3300025935 Ga0207709_10120758 Ga0207709_101207582 432
13 3300048919 Ga0496116_0067516 Ga0496116_0067516_937_2241 432
14 iso_pu_bacteria 2971403814 2971408965 432
15 3300037312 Ga0395899_0007512 Ga0395899_0007512_4593_5918 433
16 3300037418 Ga0395900_0022427 Ga0395900_0022427_4224_5549 433
17 3300037466 Ga0395898_0024364 Ga0395898_0024364_4405_5730 433
18 3300038443 Ga0395901_0045148 Ga0395901_0045148_231_1556 433
19 3300044712 Ga0453684_0007481 Ga0453684_0007481_11567_12895 433
20 iso_pu_bacteria 2576861424 2578338222 433
21 3300037418 Ga0395900_0129902 Ga0395900_0129902_1083_2423 435
22 3300046515 Ga0495620_0026918 Ga0495620_0026918_655_1962 435
23 3300046530 Ga0495654_0098226 Ga0495654_0098226_22_1329 435
24 3300049571 Ga0501034_0000433 Ga0501034_0000433_29922_31241 435
25 3300049572 Ga0501036_0005103 Ga0501036_0005103_6792_8111 435
26 iso_pu_bacteria 2818991465 2819708381 435
27 iso_pu_bacteria 2842882022 2842885613 435
28 iso_pu_bacteria 2904524088 2904528043 435
29 iso_pu_bacteria 2919517244 2919521157 435
30 iso_pu_bacteria 2929004312 2929005000 435
31 3300048919 Ga0496116_0000653 Ga0496116_0000653_18817_20136 436
32 iso_pu_bacteria 2960319331 2960322296 436
33 3300049581 Ga0501047_0081153 Ga0501047_0081153_1452_2777 437
34 iso_pu_bacteria 2936361878 2936363030 437
35 iso_pu_bacteria 2593339131 2595090121 438
36 iso_pu_bacteria 2600255286 2601639867 438
37 iso_pu_bacteria 2721755693 2723602716 438
38 iso_pu_bacteria 2728369359 2730138691 438
39 iso_pu_bacteria 2751185905 2753809421 438
40 iso_pu_bacteria 2757320391 2757567544 438
41 iso_pu_bacteria 2802428803 2802438958 438
42 iso_pu_bacteria 2889276214 2889278673 438
43 iso_pu_bacteria 2904595352 2904598720 438
44 iso_pu_bacteria 2929297113 2929298651 438
45 iso_pu_bacteria 2939702853 2939703838 438
46 iso_pu_bacteria 2996706504 2996706985 438
47 iso_pu_bacteria 648028048 648169061 438
48 3300003187 JGI25151J46595_10028376 JGI25151J46595_100283762 439
49 3300006946 Ga0079104_1000627 Ga0079104_100062720 439
50 3300025294 Ga0209025_1001453 Ga0209025_100145323 439
51 3300025294 Ga0209025_1002967 Ga0209025_100296714 439
52 3300025294 Ga0209025_1041693 Ga0209025_10416932 439
53 3300027111 Ga0209281_1000198 Ga0209281_1000198122 439
54 3300045976 Ga0466967_0002852 Ga0466967_0002852_1902_3221 439
55 iso_pu_bacteria 2585428059 2587738433 439
56 iso_pu_bacteria 2643221676 2644427054 439
57 iso_pu_bacteria 2818991459 2819669701 439
58 iso_pu_bacteria 2865002811 2865007318 439
59 iso_pu_bacteria 2904755435 2904760769 439
60 iso_pu_bacteria 2919425241 2919428499 439
61 iso_pu_bacteria 2980182181 2980186930 439
62 iso_pu_bacteria 2984527788 2984532499 439
63 iso_pu_bacteria 2984532647 2984533756 439
64 3300025294 Ga0209025_1012665 Ga0209025_10126654 440
65 iso_pu_bacteria 2571042143 2571531321 440
66 iso_pu_bacteria 2757320391 2757566278 440
67 iso_pu_bacteria 2849139964 2849142655 440
68 3300027312 Ga0209371_1002331 Ga0209371_10023313 441
69 3300030500 Ga0268256_1001680 Ga0268256_10016809 441
70 iso_pu_bacteria 8002317523 8002321202 441
71 iso_pu_bacteria 8046991243 8046991517 441
72 3300005471 Ga0070698_100025992 Ga0070698_1000259922 442
73 3300045049 Ga0466959_0030304 Ga0466959_0030304_2399_3826 442
74 iso_pu_bacteria 2571042588 2573037160 442
75 iso_pu_bacteria 2576861424 2578335502 442
76 iso_pu_bacteria 2619619294 2621273730 442
77 iso_pu_bacteria 2865002811 2865005267 442
78 iso_pu_bacteria 2881636855 2881638196 442
79 iso_pu_bacteria 2971511577 2971513219 442
80 iso_pu_bacteria 2980176882 2980178576 442
81 3300048919 Ga0496116_0058607 Ga0496116_0058607_1043_2380 443
82 3300048919 Ga0496116_0078718 Ga0496116_0078718_132_1469 443
83 3300048921 Ga0496118_0057058 Ga0496118_0057058_772_2109 443
84 3300048922 Ga0496119_0024915 Ga0496119_0024915_1900_3237 443
85 3300048923 Ga0496120_0022374 Ga0496120_0022374_1413_2750 443
86 3300048924 Ga0496121_0017988 Ga0496121_0017988_2279_3616 443
87 3300048924 Ga0496121_0099893 Ga0496121_0099893_269_1606 443
88 3300048924 Ga0496121_0152066 Ga0496121_0152066_172_1509 443
89 3300048926 Ga0496123_0034609 Ga0496123_0034609_1877_3214 443
90 3300048928 Ga0496125_0002101 Ga0496125_0002101_22904_24241 443
91 iso_pu_bacteria 2818991441 2819566873 443
92 iso_pu_bacteria 8054795415 8054802637 444
93 3300025225 Ga0209566_100198 Ga0209566_1001985 445
94 iso_pu_bacteria 8046991243 8046993057 445
95 3300006946 Ga0079104_1005118 Ga0079104_10051182 447
96 3300027111 Ga0209281_1000235 Ga0209281_100023590 447
97 3300006946 Ga0079104_1000657 Ga0079104_100065729 448
98 3300027111 Ga0209281_1000088 Ga0209281_1000088180 448
99 3300046515 Ga0495620_0030999 Ga0495620_0030999_380_1726 448
100 3300047320 Ga0495672_0005406 Ga0495672_0005406_3348_4694 448
101 3300025225 Ga0209566_100171 Ga0209566_10017117 449
102 3300027111 Ga0209281_1012869 Ga0209281_10128692 449
103 3300044712 Ga0453684_0010870 Ga0453684_0010870_6251_7636 449
104 3300006946 Ga0079104_1001164 Ga0079104_10011648 450
105 3300027111 Ga0209281_1000323 Ga0209281_100032330 450
106 3300027111 Ga0209281_1015103 Ga0209281_10151031 450
107 iso_pu_bacteria 2791355222 2793181989 450
108 3300006946 Ga0079104_1000246 Ga0079104_100024623 451
109 3300027111 Ga0209281_1000052 Ga0209281_1000052258 451
110 iso_pu_bacteria 2808606364 2808870579 452
111 iso_pu_bacteria 2889049205 2889050924 452
112 iso_pu_bacteria 2990275345 2990276217 452
113 iso_pu_bacteria 3001272096 3001274885 452
114 iso_pu_bacteria 2684622632 2685153218 453
115 iso_pu_bacteria 2738541295 2738813763 453
116 iso_pu_bacteria 2738541358 2739157011 453
117 iso_pu_bacteria 2738543006 2739209239 453
118 iso_pu_bacteria 2775507177 2777760894 453
119 iso_pu_bacteria 2889295896 2889298042 453
120 iso_pu_bacteria 2904755435 2904759159 453
121 iso_pu_bacteria 2964375228 2964375910 453
122 iso_pu_bacteria 2981284811 2981286524 453
123 iso_pu_bacteria 2981289755 2981291475 453
124 iso_pu_bacteria 2981980479 2981982167 453
125 iso_pu_bacteria 2981985349 2981987068 453
126 iso_pu_bacteria 8023444577 8023448922 453
127 iso_pu_bacteria 8056533031 8056533046 453
128 3300048927 Ga0496124_0001361 Ga0496124_0001361_27109_28479 454
129 3300048928 Ga0496125_0001931 Ga0496125_0001931_17513_18883 454
130 3300045049 Ga0466959_0042073 Ga0466959_0042073_467_1834 455
131 3300002987 JGI25159J45721_1004006 JGI25159J45721_10040062 457
132 3300009092 Ga0105250_10015696 Ga0105250_100156961 457
133 3300025284 Ga0209130_1000802 Ga0209130_100080214 457
134 3300025294 Ga0209025_1006901 Ga0209025_10069018 457
135 3300025711 Ga0207696_1022775 Ga0207696_10227752 457
136 3300030083 Ga0237817_10002 Ga0237817_1000247 457
137 3300038705 Ga0237819_00043 Ga0237819_00043_16966_18339 457

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00984

UDPG_MGDP_dh

UDP-glucose/GDP-mannose dehydrogenase family, central domain

212

305

0.99

PF03720

UDPG_MGDP_dh_C

UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain

327

435

0.98

PF03721

UDPG_MGDP_dh_N

UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain

15

198

0.96

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

16

105

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gg2-assembly1.cif.gz_B crystal structure of udp-glucose 6-dehydrogenase from porphyromonas gingivalis bound to product udp-glucuronate 0.9675 4 421
3gg2-assembly1.cif.gz_C crystal structure of udp-glucose 6-dehydrogenase from porphyromonas gingivalis bound to product udp-glucuronate 0.9651 4 435
4a7p-assembly1.cif.gz_A-2 se-met derivatized ugdg, udp-glucose dehydrogenase from sphingomonas elodea 0.9626 3 437
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 0.9597 4 32
2y0e-assembly2.cif.gz_A bcec and the final step of ugds reaction 0.9595 2 440
ID Description Score Start End Superfamily
af_O07248_1_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9738 4 197 3.40.50.720
af_B0G160_35_582_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9654 4 32 3.50.50.60
3vtfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9635 4 212 3.40.50.720
3gg2B03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9551 230 421 3.40.50.720
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9525 2 34 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A5R2NQ29-F1-model_v4 UDP-glucose 6-dehydrogenase 0.9968 3 74 GO:0016616
GO:0051287
AF-A0A268QX16-F1-model_v4 UDP-glucose/GDP-mannose dehydrogenase C-terminal domain-containing protein 0.9942 363 435 GO:0016616
GO:0051287
AF-A0A4Q6DSS8-F1-model_v4 UDP-glucose 6-dehydrogenase 0.9876 3 111 GO:0016616
GO:0051287
AF-A0A4Y1ZB06-F1-model_v4 UDP-glucose dehydrogenase (EC 1.1.1.22) 0.9869 3 218 GO:0000271
GO:0003979
GO:0051287
AF-A0A838WV55-F1-model_v4 UDP-glucose 6-dehydrogenase 0.9867 5 73 GO:0016616
GO:0051287

Feature Viewer

pLDDT pTM Quality
92.14 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map