F168604

General Info

Members Datasets Scaffolds Average Seq Length
137 97 137 226

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10096665|Ga0065707_100966653
Length 254
Sequence VWRIAILEAHRANLVRPVPAVLAALWDRIAAALPPGGATAGTIVIGGAVAKHMQVTLEIGPKGKKVVAVAPDWPGLERGAKTGEDAIERLRSYIPRYSQVAKLAEMDAEFDTIKDVDVAEQYSGTGSTDFWGISFAFSSIDKQGMLGDELERELTLMRACWSFFDDVRSRVSAEMKRGPRGGGRDRDHIIRHTVAAEQDWARMIGVLTPDDAMLTGDGLKSHRDAYCQAIRDYHSQGKLAAWEMEDKDLTAERH

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
62 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
63 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
64 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
80 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
87 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
88 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
89 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
90 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
91 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
96 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
97 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 1.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.46
Rhizosphere 95.62
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10000773 3300005289 Bacteria 13039
2 Ga0065707_10096665 3300005295 Bacteria 3236
3 Ga0065707_10461167 3300005295 Bacteria 791
4 Ga0070683_100066943 3300005329 Bacteria 3345
5 Ga0070690_100299983 3300005330 Bacteria 1152
6 Ga0070689_100458534 3300005340 Bacteria 1086
7 Ga0070689_100581549 3300005340 Bacteria 968
8 Ga0070659_100329346 3300005366 Bacteria 1278
9 Ga0070714_100036831 3300005435 Bacteria 4106
10 Ga0070713_100000128 3300005436 Bacteria 50175
11 Ga0070694_100370432 3300005444 Bacteria 1115
12 Ga0070708_100131844 3300005445 Bacteria 2313
13 Ga0070706_100025054 3300005467 Bacteria 5491
14 Ga0070706_100127734 3300005467 Bacteria 2371
15 Ga0070707_100021257 3300005468 Bacteria 6134
16 Ga0070707_100030886 3300005468 Bacteria 5102
17 Ga0070707_100095292 3300005468 Bacteria 2882
18 Ga0070707_100103554 3300005468 Bacteria 2758
19 Ga0070707_100784648 3300005468 Bacteria 916
20 Ga0070698_100033556 3300005471 Bacteria 5316
21 Ga0070698_100062027 3300005471 Bacteria 3772
22 Ga0070698_100109954 3300005471 Bacteria 2722
23 Ga0070698_100112058 3300005471 Bacteria 2693
24 Ga0070698_100341967 3300005471 Bacteria 1428
25 Ga0070698_100789329 3300005471 Bacteria 893
26 Ga0070699_100029538 3300005518 Bacteria 4726
27 Ga0070699_100486855 3300005518 Bacteria 1120
28 Ga0070684_100638299 3300005535 Bacteria 991
29 Ga0070697_100547362 3300005536 Bacteria 1015
30 Ga0070696_100283805 3300005546 Bacteria 1263
31 Ga0070704_100761816 3300005549 Bacteria 863
32 Ga0068857_100370539 3300005577 Bacteria 1328
33 Ga0068859_100032521 3300005617 Bacteria 5239
34 Ga0068864_100094541 3300005618 Bacteria 2642
35 Ga0070717_10068598 3300006028 Bacteria 2952
36 Ga0070717_10095751 3300006028 Bacteria 2513
37 Ga0075428_100692523 3300006844 Bacteria 1086
38 Ga0075430_100513446 3300006846 Bacteria 989
39 Ga0075431_100122385 3300006847 Bacteria 2684
40 Ga0075429_100034023 3300006880 Bacteria 4427
41 Ga0075429_100490399 3300006880 Bacteria 1076
42 Ga0097620_100032521 3300006931 Bacteria 5239
43 Ga0111539_10208791 3300009094 Bacteria 2275
44 Ga0105247_10364182 3300009101 Bacteria 1020
45 Ga0114129_10255680 3300009147 Bacteria 2350
46 Ga0105243_10722934 3300009148 Bacteria 973
47 Ga0105237_10114422 3300009545 Bacteria 2690
48 Ga0105238_11195534 3300009551 Bacteria 785
49 Ga0105246_10539418 3300011119 Bacteria 998
50 Ga0157378_10494560 3300013297 Bacteria 1221
51 Ga0163162_11137536 3300013306 Bacteria 885
52 Ga0163161_10321675 3300017792 Bacteria 1223
53 Ga0213876_10282930 3300021384 Bacteria 881
54 Ga0213875_10017061 3300021388 Bacteria 3513
55 Ga0224712_10035038 3300022467 Bacteria 1850
56 Ga0207688_10413796 3300025901 Bacteria 837
57 Ga0207699_10000091 3300025906 Bacteria 67284
58 Ga0207684_10030471 3300025910 Bacteria 4591
59 Ga0207684_10088572 3300025910 Bacteria 2637
60 Ga0207684_10256957 3300025910 Bacteria 1507
61 Ga0207660_10240739 3300025917 Bacteria 1425
62 Ga0207646_10021814 3300025922 Bacteria 5910
63 Ga0207646_10081737 3300025922 Bacteria 2889
64 Ga0207646_10102613 3300025922 Bacteria 2564
65 Ga0207646_10180025 3300025922 Bacteria 1909
66 Ga0207646_10493159 3300025922 Bacteria 1104
67 Ga0207681_10343748 3300025923 Bacteria 1193
68 Ga0207700_10000608 3300025928 Bacteria 21003
69 Ga0207664_10815480 3300025929 Bacteria 839
70 Ga0207709_10149268 3300025935 Bacteria 1617
71 Ga0207661_10448974 3300025944 Bacteria 1174
72 Ga0207661_10850460 3300025944 Bacteria 840
73 Ga0207679_10783999 3300025945 Bacteria 868
74 Ga0207658_10510693 3300025986 Bacteria 1072
75 Ga0207703_10510105 3300026035 Bacteria 1130
76 Ga0207708_10172254 3300026075 Bacteria 1715
77 Ga0207708_10261952 3300026075 Bacteria 1396
78 Ga0207676_10105342 3300026095 Bacteria 2348
79 Ga0207674_10365757 3300026116 Bacteria 1394
80 Ga0268265_10010868 3300028380 Bacteria 6149
81 Ga0268265_10721993 3300028380 Bacteria 965
82 Ga0265324_10162246 3300029957 Bacteria 759
83 Ga0265760_10074569 3300031090 Bacteria 1044
84 Ga0265340_10087592 3300031247 Bacteria 1459
85 Ga0373950_0025074 3300034818 Bacteria 1075
86 Ga0373954_0004079 3300035118 Bacteria 6259
87 Ga0373956_0002879 3300035119 Bacteria 6965
88 Ga0373955_0125901 3300035172 Bacteria 1493
89 Ga0373933_0008165 3300035724 Bacteria 5713
90 Ga0373937_0354487 3300036401 Bacteria 1390
91 Ga0316584_0347835 3300036712 Unclassified 1065
92 Ga0436364_0935218 3300037853 Bacteria 1541
93 Ga0436365_1397424 3300039437 Bacteria 1325
94 Ga0451577_0042345 3300042876 Bacteria 4085
95 Ga0451577_0249689 3300042876 Bacteria 1606
96 Ga0451577_0413874 3300042876 Bacteria 1224
97 Ga0451577_0777181 3300042876 Bacteria 866
98 Ga0466965_0267215 3300044683 Bacteria 921
99 Ga0466961_0052536 3300044693 Bacteria 2601
100 Ga0453684_0011772 3300044712 Bacteria 14581
101 Ga0453684_0041372 3300044712 Bacteria 6234
102 Ga0453684_0085478 3300044712 Bacteria 3919
103 Ga0453684_0129117 3300044712 Bacteria 3035
104 Ga0453684_0407042 3300044712 Bacteria 1522
105 Ga0453684_0483202 3300044712 Bacteria 1374
106 Ga0453684_0698912 3300044712 Bacteria 1102
107 Ga0466971_0020750 3300044719 Bacteria 2920
108 Ga0466968_0052371 3300044735 Bacteria 1746
109 Ga0466959_0019677 3300045049 Bacteria 4966
110 Ga0451576_0207465 3300045051 Unclassified 2046
111 Ga0466967_0260811 3300045976 Bacteria 1658
112 Ga0496108_0686839 3300048911 Bacteria 888
113 Ga0496111_0161614 3300048914 Bacteria 1663
114 Ga0501038_0542915 3300049574 Bacteria 885
115 Ga0501046_0188040 3300049580 Bacteria 1542
116 Ga0501071_0084450 3300049587 Bacteria 2327
117 Ga0501075_0158620 3300049591 Bacteria 1726
118 Ga0501076_0163288 3300049592 Bacteria 1815
119 Ga0501077_0240884 3300049593 Bacteria 1150
120 Ga0501081_0131804 3300049743 Bacteria 1786
121 nmdc:mga05p37_11445_c1 3300050507 Bacteria 10564
122 nmdc:mga05p37_322422_c1 3300050507 Bacteria 1828
123 nmdc:mga05p37_79646_c1 3300050507 Bacteria 4034
124 nmdc:mga09592_150210_c1 3300050508 Bacteria 1454
125 nmdc:mga09592_15769_c2 3300050508 Bacteria 4341
126 nmdc:mga06r32_544621_c1 3300050510 Bacteria 1135
127 nmdc:mga08y16_139790_c1 3300050511 Bacteria 2517
128 nmdc:mga08y16_797649_c1 3300050511 Bacteria 937
129 nmdc:mga0n895_150490_c1 3300050512 Bacteria 2357
130 nmdc:mga0a205_401740_c1 3300050515 Bacteria 1234
131 Ga0501084_0084706 3300054114 Bacteria 2661
132 Ga0501084_0178804 3300054114 Bacteria 1791
133 Ga0501084_0252678 3300054114 Bacteria 1488
134 Ga0501082_0209782 3300060353 Bacteria 1695
135 Ga0466962_0053836 3300061719 Unclassified 1923
136 Ga0530510_0009607 3300061734 Bacteria 6783
137 Ga0530510_0021028 3300061734 Bacteria 4641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0413874 Ga0451577_0413874_208_924 200
2 3300044712 Ga0453684_0407042 Ga0453684_0407042_162_878 200
3 3300044712 Ga0453684_0011772 Ga0453684_0011772_13571_14260 202
4 3300005295 Ga0065707_10096665 Ga0065707_100966653 203
5 3300005617 Ga0068859_100032521 Ga0068859_1000325214 203
6 3300005618 Ga0068864_100094541 Ga0068864_1000945413 203
7 3300006847 Ga0075431_100122385 Ga0075431_1001223853 203
8 3300006880 Ga0075429_100490399 Ga0075429_1004903992 203
9 3300006931 Ga0097620_100032521 Ga0097620_1000325214 203
10 3300009094 Ga0111539_10208791 Ga0111539_102087913 203
11 3300009101 Ga0105247_10364182 Ga0105247_103641821 203
12 3300009545 Ga0105237_10114422 Ga0105237_101144224 203
13 3300013297 Ga0157378_10494560 Ga0157378_104945602 203
14 3300013306 Ga0163162_11137536 Ga0163162_111375361 203
15 3300025901 Ga0207688_10413796 Ga0207688_104137961 203
16 3300025923 Ga0207681_10343748 Ga0207681_103437482 203
17 3300026095 Ga0207676_10105342 Ga0207676_101053423 203
18 3300028380 Ga0268265_10010868 Ga0268265_100108687 203
19 3300049574 Ga0501038_0542915 Ga0501038_0542915_12_716 203
20 3300049591 Ga0501075_0158620 Ga0501075_0158620_709_1422 203
21 3300049592 Ga0501076_0163288 Ga0501076_0163288_822_1535 203
22 3300050508 nmdc:mga09592_150210_c1 nmdc:mga09592_150210_c1_589_1323 203
23 3300050510 nmdc:mga06r32_544621_c1 nmdc:mga06r32_544621_c1_53_787 203
24 3300050511 nmdc:mga08y16_139790_c1 nmdc:mga08y16_139790_c1_1139_1840 203
25 3300054114 Ga0501084_0178804 Ga0501084_0178804_138_851 203
26 3300025917 Ga0207660_10240739 Ga0207660_102407391 204
27 3300025935 Ga0207709_10149268 Ga0207709_101492682 204
28 3300009148 Ga0105243_10722934 Ga0105243_107229341 210
29 3300025929 Ga0207664_10815480 Ga0207664_108154801 211
30 3300005435 Ga0070714_100036831 Ga0070714_1000368312 212
31 3300044712 Ga0453684_0483202 Ga0453684_0483202_227_934 214
32 3300060353 Ga0501082_0209782 Ga0501082_0209782_141_911 215
33 3300005295 Ga0065707_10461167 Ga0065707_104611671 222
34 3300005329 Ga0070683_100066943 Ga0070683_1000669434 222
35 3300005340 Ga0070689_100458534 Ga0070689_1004585341 222
36 3300005340 Ga0070689_100581549 Ga0070689_1005815491 222
37 3300005366 Ga0070659_100329346 Ga0070659_1003293462 222
38 3300005436 Ga0070713_100000128 Ga0070713_10000012836 222
39 3300005444 Ga0070694_100370432 Ga0070694_1003704322 222
40 3300005445 Ga0070708_100131844 Ga0070708_1001318444 222
41 3300005467 Ga0070706_100025054 Ga0070706_1000250545 222
42 3300005467 Ga0070706_100127734 Ga0070706_1001277345 222
43 3300005468 Ga0070707_100021257 Ga0070707_1000212576 222
44 3300005468 Ga0070707_100030886 Ga0070707_1000308863 222
45 3300005468 Ga0070707_100095292 Ga0070707_1000952922 222
46 3300005468 Ga0070707_100103554 Ga0070707_1001035542 222
47 3300005468 Ga0070707_100784648 Ga0070707_1007846481 222
48 3300005471 Ga0070698_100033556 Ga0070698_1000335566 222
49 3300005471 Ga0070698_100062027 Ga0070698_1000620273 222
50 3300005471 Ga0070698_100112058 Ga0070698_1001120582 222
51 3300005471 Ga0070698_100341967 Ga0070698_1003419672 222
52 3300005471 Ga0070698_100789329 Ga0070698_1007893291 222
53 3300005518 Ga0070699_100029538 Ga0070699_1000295383 222
54 3300005535 Ga0070684_100638299 Ga0070684_1006382992 222
55 3300005536 Ga0070697_100547362 Ga0070697_1005473621 222
56 3300005546 Ga0070696_100283805 Ga0070696_1002838051 222
57 3300005549 Ga0070704_100761816 Ga0070704_1007618161 222
58 3300005577 Ga0068857_100370539 Ga0068857_1003705392 222
59 3300006028 Ga0070717_10068598 Ga0070717_100685983 222
60 3300006028 Ga0070717_10095751 Ga0070717_100957512 222
61 3300006844 Ga0075428_100692523 Ga0075428_1006925232 222
62 3300017792 Ga0163161_10321675 Ga0163161_103216752 222
63 3300021384 Ga0213876_10282930 Ga0213876_102829302 222
64 3300021388 Ga0213875_10017061 Ga0213875_100170612 222
65 3300022467 Ga0224712_10035038 Ga0224712_100350382 222
66 3300025906 Ga0207699_10000091 Ga0207699_1000009136 222
67 3300025910 Ga0207684_10030471 Ga0207684_100304711 222
68 3300025910 Ga0207684_10088572 Ga0207684_100885721 222
69 3300025910 Ga0207684_10256957 Ga0207684_102569572 222
70 3300025922 Ga0207646_10021814 Ga0207646_100218143 222
71 3300025922 Ga0207646_10081737 Ga0207646_100817373 222
72 3300025922 Ga0207646_10102613 Ga0207646_101026132 222
73 3300025922 Ga0207646_10180025 Ga0207646_101800252 222
74 3300025922 Ga0207646_10493159 Ga0207646_104931591 222
75 3300025928 Ga0207700_10000608 Ga0207700_1000060811 222
76 3300025944 Ga0207661_10448974 Ga0207661_104489741 222
77 3300025944 Ga0207661_10850460 Ga0207661_108504601 222
78 3300025945 Ga0207679_10783999 Ga0207679_107839991 222
79 3300026035 Ga0207703_10510105 Ga0207703_105101051 222
80 3300026075 Ga0207708_10172254 Ga0207708_101722542 222
81 3300026116 Ga0207674_10365757 Ga0207674_103657571 222
82 3300028380 Ga0268265_10721993 Ga0268265_107219931 222
83 3300029957 Ga0265324_10162246 Ga0265324_101622461 222
84 3300031090 Ga0265760_10074569 Ga0265760_100745691 222
85 3300031247 Ga0265340_10087592 Ga0265340_100875922 222
86 3300035118 Ga0373954_0004079 Ga0373954_0004079_1638_2315 222
87 3300035119 Ga0373956_0002879 Ga0373956_0002879_1001_1678 222
88 3300035172 Ga0373955_0125901 Ga0373955_0125901_629_1306 222
89 3300035724 Ga0373933_0008165 Ga0373933_0008165_4625_5302 222
90 3300036401 Ga0373937_0354487 Ga0373937_0354487_284_961 222
91 3300037853 Ga0436364_0935218 Ga0436364_0935218_643_1323 222
92 3300039437 Ga0436365_1397424 Ga0436365_1397424_452_1129 222
93 3300042876 Ga0451577_0042345 Ga0451577_0042345_3369_4046 222
94 3300044683 Ga0466965_0267215 Ga0466965_0267215_166_846 222
95 3300044693 Ga0466961_0052536 Ga0466961_0052536_906_1577 222
96 3300044719 Ga0466971_0020750 Ga0466971_0020750_1215_1886 222
97 3300044735 Ga0466968_0052371 Ga0466968_0052371_704_1375 222
98 3300045049 Ga0466959_0019677 Ga0466959_0019677_1153_1824 222
99 3300045976 Ga0466967_0260811 Ga0466967_0260811_830_1507 222
100 3300048911 Ga0496108_0686839 Ga0496108_0686839_62_739 222
101 3300048914 Ga0496111_0161614 Ga0496111_0161614_409_1086 222
102 3300049580 Ga0501046_0188040 Ga0501046_0188040_160_837 222
103 3300049587 Ga0501071_0084450 Ga0501071_0084450_915_1592 222
104 3300049593 Ga0501077_0240884 Ga0501077_0240884_289_966 222
105 3300049743 Ga0501081_0131804 Ga0501081_0131804_131_808 222
106 3300050511 nmdc:mga08y16_797649_c1 nmdc:mga08y16_797649_c1_196_903 222
107 3300050512 nmdc:mga0n895_150490_c1 nmdc:mga0n895_150490_c1_997_1674 222
108 3300050515 nmdc:mga0a205_401740_c1 nmdc:mga0a205_401740_c1_432_1109 222
109 3300054114 Ga0501084_0084706 Ga0501084_0084706_22_729 222
110 3300054114 Ga0501084_0252678 Ga0501084_0252678_517_1194 222
111 3300061719 Ga0466962_0053836 Ga0466962_0053836_1137_1808 222
112 3300061734 Ga0530510_0009607 Ga0530510_0009607_3546_4223 222
113 3300061734 Ga0530510_0021028 Ga0530510_0021028_3847_4524 222
114 3300044712 Ga0453684_0698912 Ga0453684_0698912_298_1002 224
115 3300005289 Ga0065704_10000773 Ga0065704_100007739 225
116 3300005330 Ga0070690_100299983 Ga0070690_1002999832 225
117 3300005471 Ga0070698_100109954 Ga0070698_1001099544 225
118 3300005518 Ga0070699_100486855 Ga0070699_1004868551 225
119 3300006846 Ga0075430_100513446 Ga0075430_1005134461 225
120 3300006880 Ga0075429_100034023 Ga0075429_1000340233 225
121 3300009147 Ga0114129_10255680 Ga0114129_102556801 225
122 3300009551 Ga0105238_11195534 Ga0105238_111955341 225
123 3300011119 Ga0105246_10539418 Ga0105246_105394181 225
124 3300025986 Ga0207658_10510693 Ga0207658_105106931 225
125 3300026075 Ga0207708_10261952 Ga0207708_102619522 225
126 3300034818 Ga0373950_0025074 Ga0373950_0025074_305_1009 225
127 3300036712 Ga0316584_0347835 Ga0316584_0347835_84_785 225
128 3300042876 Ga0451577_0249689 Ga0451577_0249689_433_1116 225
129 3300042876 Ga0451577_0777181 Ga0451577_0777181_133_849 225
130 3300044712 Ga0453684_0041372 Ga0453684_0041372_936_1646 225
131 3300044712 Ga0453684_0085478 Ga0453684_0085478_295_978 225
132 3300044712 Ga0453684_0129117 Ga0453684_0129117_291_1007 225
133 3300045051 Ga0451576_0207465 Ga0451576_0207465_606_1292 225
134 3300050507 nmdc:mga05p37_11445_c1 nmdc:mga05p37_11445_c1_6731_7447 225
135 3300050507 nmdc:mga05p37_322422_c1 nmdc:mga05p37_322422_c1_743_1480 225
136 3300050507 nmdc:mga05p37_79646_c1 nmdc:mga05p37_79646_c1_1286_1972 225
137 3300050508 nmdc:mga09592_15769_c2 nmdc:mga09592_15769_c2_673_1389 225

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iyy-assembly1.cif.gz_A crystal structure of human wipi3,loop deletion mutant 0.6376 8 34
3k6q-assembly2.cif.gz_D crystal structure of an antitoxin part of a putative toxin/antitoxin system (swol_0700) from syntrophomonas wolfei subsp. wolfei at 1.80 a resolution 0.6272 4 64
6e29-assembly1.cif.gz_A crystal structure of myceliophteria_thermophila cps50 (swd1) beta-propeller domain 0.6221 8 33
1wv8-assembly1.cif.gz_A-2 crystal structure of hypothetical protein ttha1013 from an extremely thermophilic bacterium thermus thermophilus hb8 0.6218 4 75
6e29-assembly4.cif.gz_D crystal structure of myceliophteria_thermophila cps50 (swd1) beta-propeller domain 0.6121 8 33
ID Description Score Start End Superfamily
af_O53773_242_434_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7504 105 221 1.20.120.450
3k6qA02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7245 5 50 3.30.160.620
af_P72040_13_192_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.7023 105 221 1.10.30.50
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6582 109 220 1.20.120.450
af_Q02887_278_494_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6522 7 33 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A6P0Q608-F1-model_v4 Uncharacterized protein 0.9543 110 224
AF-A0A838UYZ6-F1-model_v4 DinB-like domain-containing protein 0.936 40 224
AF-A0A1Q7C327-F1-model_v4 DinB-like domain-containing protein 0.9359 97 224
AF-A0A7W1HI32-F1-model_v4 DinB family protein 0.9338 1 224
AF-A0A7V8Z585-F1-model_v4 DinB family protein 0.9258 4 223

Feature Viewer

pLDDT pTM Quality
83.43 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map