F167055

General Info

Members Datasets Scaffolds Average Seq Length
136 114 272 148

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10022912|Ga0265324_100229122
Length 170
Sequence MNIQARDIKNILLVEDDLRDVELTLAALEEHHLANAVFVVHDGAEALDYLYHRGKFKGRAPGNPVVVLLDNKMPKVNGLEVLKTIKADPQLKMIPVVMLTSSRETPDLVEFYKHGVNAYVVKPVNFSDFMVAVKQLGIFWAAVNEPPPQIQEVKAAVQGGEDVLPPKDKA

Samples

Sample ID Description Type Environment
1 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
75 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
112 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 0
Rhizosphere 96.32
Stem 0
Stem Tuber 0
Unclassified 13.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265324_10022912 3300029957 Bacteria 2228
2 rootL2_10369788 3300003322 Bacteria 1203
3 Ga0070680_100415011 3300005336 Bacteria 1148
4 Ga0070667_100496606 3300005367 Bacteria 1118
5 Ga0070714_100079403 3300005435 Bacteria 2853
6 Ga0070705_100377491 3300005440 Bacteria 1042
7 Ga0070694_100035700 3300005444 Bacteria 3289
8 Ga0070694_100536664 3300005444 Bacteria 935
9 Ga0070708_100055484 3300005445 Bacteria 3524
10 Ga0070681_10287262 3300005458 Bacteria 1555
11 Ga0070706_100377907 3300005467 Bacteria 1320
12 Ga0070707_100142107 3300005468 Bacteria 2336
13 Ga0070707_100520805 3300005468 Bacteria 1151
14 Ga0070699_100626743 3300005518 Bacteria 981
15 Ga0070699_100735556 3300005518 Bacteria 902
16 Ga0070697_100082339 3300005536 Bacteria 2653
17 Ga0070697_100235045 3300005536 Bacteria 1564
18 Ga0070697_100923386 3300005536 Unclassified 775
19 Ga0070695_100089811 3300005545 Bacteria 2049
20 Ga0070696_100290794 3300005546 Bacteria 1248
21 Ga0068857_100000212 3300005577 Bacteria 38047
22 Ga0068852_100184721 3300005616 Bacteria 1963
23 Ga0068851_10341568 3300005834 Unclassified 869
24 Ga0068858_100022375 3300005842 Bacteria 5901
25 Ga0068860_101408215 3300005843 Bacteria 718
26 Ga0081540_1075106 3300005983 Bacteria 1545
27 Ga0097621_100089030 3300006237 Bacteria 2580
28 Ga0075430_100207932 3300006846 Bacteria 1624
29 Ga0097620_101147219 3300006931 Bacteria 855
30 Ga0099794_10004250 3300007265 Bacteria 5595
31 Ga0105240_10157474 3300009093 Bacteria 2700
32 Ga0105245_10799122 3300009098 Bacteria 981
33 Ga0105241_10085432 3300009174 Unclassified 2480
34 Ga0105242_10291122 3300009176 Bacteria 1487
35 Ga0105248_10068112 3300009177 Bacteria 3997
36 Ga0105237_10002916 3300009545 Bacteria 20717
37 Ga0099796_10088144 3300010159 Unclassified 1149
38 Ga0157370_10009197 3300013104 Bacteria 10595
39 Ga0157374_12606073 3300013296 Unclassified 533
40 Ga0163162_10289940 3300013306 Bacteria 1769
41 Ga0228598_1084902 3300024227 Bacteria 636
42 Ga0207707_10234903 3300025912 Bacteria 1595
43 Ga0207671_10011717 3300025914 Bacteria 7104
44 Ga0207646_10369679 3300025922 Bacteria 1295
45 Ga0207646_10439872 3300025922 Bacteria 1177
46 Ga0207664_10064170 3300025929 Bacteria 2936
47 Ga0207686_10174206 3300025934 Bacteria 1520
48 Ga0207670_10097757 3300025936 Bacteria 2091
49 Ga0207658_10351776 3300025986 Bacteria 1283
50 Ga0207703_10006531 3300026035 Bacteria 9303
51 Ga0207674_10000911 3300026116 Bacteria 38519
52 Ga0207675_101635469 3300026118 Unclassified 664
53 Ga0207698_11477064 3300026142 Bacteria 695
54 Ga0209969_1007813 3300027360 Bacteria 1513
55 Ga0209967_1000470 3300027364 Bacteria 5301
56 Ga0209996_1005583 3300027395 Bacteria 1612
57 Ga0209984_1003558 3300027424 Bacteria 1789
58 Ga0210000_1001952 3300027462 Bacteria 2909
59 Ga0210000_1015052 3300027462 Bacteria 1162
60 Ga0209995_1001928 3300027471 Bacteria 3245
61 Ga0209999_1004211 3300027543 Bacteria 2591
62 Ga0209982_1036056 3300027552 Bacteria 784
63 Ga0209970_1006042 3300027614 Bacteria 1987
64 Ga0209983_1040147 3300027665 Bacteria 1011
65 Ga0209983_1084181 3300027665 Bacteria 714
66 Ga0209971_1121912 3300027682 Bacteria 641
67 Ga0209974_10005495 3300027876 Bacteria 4453
68 Ga0209974_10008698 3300027876 Bacteria 3460
69 Ga0265355_1013901 3300028036 Bacteria 674
70 Ga0268264_11974847 3300028381 Unclassified 593
71 Ga0265337_1003336 3300028556 Bacteria 6995
72 Ga0265336_10004285 3300028666 Bacteria 5422
73 Ga0265338_10025766 3300028800 Bacteria 5956
74 Ga0265338_10143839 3300028800 Bacteria 1863
75 Ga0265338_10210017 3300028800 Bacteria 1462
76 Ga0265338_10215900 3300028800 Bacteria 1436
77 Ga0265320_10068142 3300031240 Bacteria 1682
78 Ga0307508_10084318 3300031616 Unclassified 2760
79 Ga0265314_10031733 3300031711 Bacteria 3895
80 Ga0307405_10519536 3300031731 Unclassified 958
81 Ga0373939_0031603 3300035114 Bacteria 1532
82 Ga0373933_0399609 3300035724 Bacteria 896
83 Ga0373937_0592215 3300036401 Bacteria 1053
84 Ga0436361_0888742 3300039447 Bacteria 811
85 Ga0436363_1330776 3300039450 Unclassified 3505
86 Ga0439432_053678 3300042006 Bacteria 1253
87 Ga0439449_0069500 3300042007 Bacteria 1298
88 Ga0451577_0210736 3300042876 Bacteria 1755
89 Ga0466969_0010291 3300044656 Bacteria 4961
90 Ga0453683_0009564 3300044673 Bacteria 6467
91 Ga0453683_0091504 3300044673 Bacteria 1907
92 Ga0466965_0012946 3300044683 Bacteria 3929
93 Ga0466966_0025357 3300044684 Bacteria 3873
94 Ga0466961_0000034 3300044693 Bacteria 84993
95 Ga0466964_0052553 3300044706 Bacteria 1675
96 Ga0453684_0022574 3300044712 Bacteria 9325
97 Ga0453684_0118962 3300044712 Bacteria 3194
98 Ga0453684_0194892 3300044712 Bacteria 2367
99 Ga0466959_0002351 3300045049 Bacteria 12071
100 Ga0451576_0000079 3300045051 Bacteria 242987
101 Ga0451576_0682438 3300045051 Bacteria 1079
102 Ga0451576_1086521 3300045051 Bacteria 837
103 Ga0501296_009911 3300049519 Unclassified 1124
104 Ga0501036_0062423 3300049572 Bacteria 3156
105 Ga0501037_0209702 3300049573 Bacteria 1374
106 Ga0501038_0009650 3300049574 Bacteria 8854
107 Ga0501039_0383806 3300049575 Unclassified 1103
108 Ga0501040_0116308 3300049576 Bacteria 1873
109 Ga0501040_0430921 3300049576 Bacteria 948
110 Ga0501042_0004537 3300049578 Bacteria 8855
111 Ga0501068_0041167 3300049584 Bacteria 2776
112 Ga0501071_0866900 3300049587 Unclassified 696
113 Ga0501072_0299484 3300049588 Bacteria 1278
114 Ga0501075_0003878 3300049591 Bacteria 10072
115 Ga0501076_0012099 3300049592 Bacteria 6449
116 Ga0501076_1644529 3300049592 Unclassified 527
117 Ga0501077_0195410 3300049593 Bacteria 1285
118 Ga0501079_0072623 3300049741 Bacteria 2659
119 Ga0501080_0011988 3300049742 Bacteria 7940
120 Ga0501081_0004403 3300049743 Bacteria 9036
121 Ga0501083_0394395 3300049744 Unclassified 900
122 Ga0501083_0696496 3300049744 Bacteria 661
123 Ga0501035_0194478 3300049822 Bacteria 1742
124 Ga0501044_0653960 3300049823 Unclassified 940
125 nmdc:mga0n895_551376_c1 3300050512 Unclassified 1159
126 nmdc:mga0rr50_54232_c1 3300050513 Bacteria 2986
127 nmdc:mga08x19_476002_c1 3300050514 Bacteria 880
128 nmdc:mga08x19_5633_c1 3300050514 Bacteria 7400
129 nmdc:mga0a205_168080_c1 3300050515 Unclassified 2089
130 nmdc:mga0a205_495401_c1 3300050515 Bacteria 1079
131 Ga0500583_0367992 3300053092 Bacteria 694
132 Ga0500616_0013680 3300053153 Bacteria 4698
133 Ga0501084_0493081 3300054114 Bacteria 1035
134 Ga0590075_089112 3300059424 Bacteria 800
135 Ga0501082_0012911 3300060353 Bacteria 7181
136 Ga0530510_0042323 3300061734 Bacteria 3291
137 Ga0265324_10022912
138 rootL2_10369788
139 Ga0070680_100415011
140 Ga0070667_100496606
141 Ga0070714_100079403
142 Ga0070705_100377491
143 Ga0070694_100035700
144 Ga0070694_100536664
145 Ga0070708_100055484
146 Ga0070681_10287262
147 Ga0070706_100377907
148 Ga0070707_100142107
149 Ga0070707_100520805
150 Ga0070699_100626743
151 Ga0070699_100735556
152 Ga0070697_100082339
153 Ga0070697_100235045
154 Ga0070697_100923386
155 Ga0070695_100089811
156 Ga0070696_100290794
157 Ga0068857_100000212
158 Ga0068852_100184721
159 Ga0068851_10341568
160 Ga0068858_100022375
161 Ga0068860_101408215
162 Ga0081540_1075106
163 Ga0097621_100089030
164 Ga0075430_100207932
165 Ga0097620_101147219
166 Ga0099794_10004250
167 Ga0105240_10157474
168 Ga0105245_10799122
169 Ga0105241_10085432
170 Ga0105242_10291122
171 Ga0105248_10068112
172 Ga0105237_10002916
173 Ga0099796_10088144
174 Ga0157370_10009197
175 Ga0157374_12606073
176 Ga0163162_10289940
177 Ga0228598_1084902
178 Ga0207707_10234903
179 Ga0207671_10011717
180 Ga0207646_10369679
181 Ga0207646_10439872
182 Ga0207664_10064170
183 Ga0207686_10174206
184 Ga0207670_10097757
185 Ga0207658_10351776
186 Ga0207703_10006531
187 Ga0207674_10000911
188 Ga0207675_101635469
189 Ga0207698_11477064
190 Ga0209969_1007813
191 Ga0209967_1000470
192 Ga0209996_1005583
193 Ga0209984_1003558
194 Ga0210000_1001952
195 Ga0210000_1015052
196 Ga0209995_1001928
197 Ga0209999_1004211
198 Ga0209982_1036056
199 Ga0209970_1006042
200 Ga0209983_1040147
201 Ga0209983_1084181
202 Ga0209971_1121912
203 Ga0209974_10005495
204 Ga0209974_10008698
205 Ga0265355_1013901
206 Ga0268264_11974847
207 Ga0265337_1003336
208 Ga0265336_10004285
209 Ga0265338_10025766
210 Ga0265338_10143839
211 Ga0265338_10210017
212 Ga0265338_10215900
213 Ga0265320_10068142
214 Ga0307508_10084318
215 Ga0265314_10031733
216 Ga0307405_10519536
217 Ga0373939_0031603
218 Ga0373933_0399609
219 Ga0373937_0592215
220 Ga0436361_0888742
221 Ga0436363_1330776
222 Ga0439432_053678
223 Ga0439449_0069500
224 Ga0451577_0210736
225 Ga0466969_0010291
226 Ga0453683_0009564
227 Ga0453683_0091504
228 Ga0466965_0012946
229 Ga0466966_0025357
230 Ga0466961_0000034
231 Ga0466964_0052553
232 Ga0453684_0022574
233 Ga0453684_0118962
234 Ga0453684_0194892
235 Ga0466959_0002351
236 Ga0451576_0000079
237 Ga0451576_0682438
238 Ga0451576_1086521
239 Ga0501296_009911
240 Ga0501036_0062423
241 Ga0501037_0209702
242 Ga0501038_0009650
243 Ga0501039_0383806
244 Ga0501040_0116308
245 Ga0501040_0430921
246 Ga0501042_0004537
247 Ga0501068_0041167
248 Ga0501071_0866900
249 Ga0501072_0299484
250 Ga0501075_0003878
251 Ga0501076_0012099
252 Ga0501076_1644529
253 Ga0501077_0195410
254 Ga0501079_0072623
255 Ga0501080_0011988
256 Ga0501081_0004403
257 Ga0501083_0394395
258 Ga0501083_0696496
259 Ga0501035_0194478
260 Ga0501044_0653960
261 nmdc:mga0n895_551376_c1
262 nmdc:mga0rr50_54232_c1
263 nmdc:mga08x19_476002_c1
264 nmdc:mga08x19_5633_c1
265 nmdc:mga0a205_168080_c1
266 nmdc:mga0a205_495401_c1
267 Ga0500583_0367992
268 Ga0500616_0013680
269 Ga0501084_0493081
270 Ga0590075_089112
271 Ga0501082_0012911
272 Ga0530510_0042323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

11

134

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k68-assembly1.cif.gz_B crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa 0.928 12 153
1jlk-assembly1.cif.gz_B crystal structure of the mn(2+)-bound form of response regulator rcp1 0.9232 13 153
1k68-assembly1.cif.gz_B crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa 0.9153 12 153
3h1g-assembly1.cif.gz_A crystal structure of chey mutant t84a of helicobacter pylori 0.9118 13 141
1jlk-assembly1.cif.gz_B crystal structure of the mn(2+)-bound form of response regulator rcp1 0.9107 13 153
ID Description Score Start End Superfamily
1jlkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9303 12 153 3.40.50.2300
1jlkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9115 12 153 3.40.50.2300
1k66B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8973 13 158 3.40.50.2300
3h1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8963 13 141 3.40.50.2300
3hebB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.884 15 144 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1G9RK82-F1-model_v4 Two-component system, unclassified family, response regulator 0.9654 13 150 GO:0000160
AF-A0A1Q8A1Z6-F1-model_v4 Two-component system response regulator 0.9618 13 152 GO:0000160
AF-A0A348P099-F1-model_v4 Two-component system response regulator 0.9605 13 152 GO:0000160
AF-A0A2N1R2I6-F1-model_v4 Two-component system response regulator 0.9598 13 152 GO:0000160
AF-A0A2V8MT46-F1-model_v4 Two-component system response regulator 0.9595 13 153 GO:0000160

Map